KEGG   Amycolatopsis sp. YIM 10: YIM_39180
Entry
YIM_39180         CDS       T06270                                 

Gene name
cefE1
Definition
(GenBank) Deacetoxycephalosporin C synthase
  KO
K04126  isopenicillin-N synthase [EC:1.21.3.1]
Organism
amyy  Amycolatopsis sp. YIM 10
Pathway
amyy00311  Penicillin and cephalosporin biosynthesis
amyy01100  Metabolic pathways
amyy01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:amyy00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    YIM_39180 (cefE1)
Enzymes [BR:amyy01000]
 1. Oxidoreductases
  1.21  Catalysing the reaction X-H + Y-H = X-Y
   1.21.3  With oxygen as acceptor
    1.21.3.1  isopenicillin-N synthase
     YIM_39180 (cefE1)
SSDB
Motif
Pfam: DIOX_N 2OG-FeII_Oxy
Other DBs
NCBI-ProteinID: QFU92988
UniProt: A0A5P9PX71
LinkDB
Position
complement(8248700..8249683)
AA seq 327 aa
MKMPSAEVPTIDVSPLFGDNADEKVRVGQEINKACRGSGFFYASNHGVDVQMLQDVVNEF
HRTMSDEEKHALAINAYNPDNPHVRNGYYKAIPGKKAVESFCYLNPSFSEEHPEIRAGTP
MHEVNIWPDEGKHPRFRPFCEEYYWTMHRLSKVMMRGFALALGKAEDFFEPELKEEDTLS
SVSLIRYPYLEDYPPVKTGPDGVKLSFEDHFDVSMITVLYQTQVQNLQVETVDGWQDLPT
SEDNFLVNAGTYLAHLTHDYFPAPLHRVKFVNAERLSLPFFFHAGQHTLLEPFHPDGAPN
GERNEPVRYGHYLNHGLHSLIVKNGQT
NT seq 984 nt   +upstreamnt  +downstreamnt
atgaagatgccgtcagcagaggttccgaccatcgacgtctcaccgctcttcggggacaac
gccgacgagaaggtccgcgtgggccaggaaatcaacaaggcctgccgcggctcgggtttc
ttctacgcgtccaaccacggtgtcgatgtgcagatgctgcaggacgtggtgaacgagttc
caccggaccatgtcggacgaagagaagcacgcgctggcgatcaacgcctacaacccggac
aacccgcacgtgcgcaacgggtactacaaggcgatcccgggcaagaaggcggtggaatcc
ttctgctacctgaacccgtccttctccgaggaacacccggagatcagggcgggcaccccg
atgcacgaggtgaacatctggccggacgagggaaagcacccgcggttccgcccgttctgc
gaggagtactactggaccatgcaccgcctgtccaaggtgatgatgcgtggtttcgcgctg
gcgctgggcaaggcggaggacttcttcgaaccggagctgaaggaggaggacacgctctcc
tcggtctcgctgatccggtacccgtacctggaggactacccgccggtgaaaaccggcccg
gacggcgtgaagctgagcttcgaggaccacttcgacgtttcgatgatcaccgtgctgtac
cagacgcaggtgcagaacctccaggtcgagacggtcgacggctggcaggacctgcccacc
tcggaggacaacttcctggtcaacgccggcacctacctggcgcacctgacccacgactac
ttcccggccccgctgcaccgggtgaagttcgtcaacgcggagcgcctgtcgctgccgttc
ttcttccacgccgggcagcacacgctgctcgaacccttccaccccgacggcgcgccgaat
ggggagcgcaacgaacccgtccgctacggccactacctcaaccacggtctgcactcgctg
atcgtgaagaacgggcagacctga

DBGET integrated database retrieval system