Aotus nancymaae (Ma's night monkey): 105711654 Help Entry 105711654         CDS       T10127                                  Symbol IL4 Name (RefSeq) interleukin-4 isoform X1   KO K05430   interleukin 4 Organism anan  Aotus nancymaae (Ma's night monkey) Pathway anan04060   Cytokine-cytokine receptor interaction anan04151   PI3K-Akt signaling pathway anan04630   JAK-STAT signaling pathway anan04640   Hematopoietic cell lineage anan04657   IL-17 signaling pathway anan04658   Th1 and Th2 cell differentiation anan04659   Th17 cell differentiation anan04660   T cell receptor signaling pathway anan04664   Fc epsilon RI signaling pathway anan04672   Intestinal immune network for IgA production anan05140   Leishmaniasis anan05200   Pathways in cancer anan05310   Asthma anan05320   Autoimmune thyroid disease anan05321   Inflammatory bowel disease anan05330   Allograft rejection Brite KEGG Orthology (KO) [BR:anan00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     105711654 (IL4)    04151 PI3K-Akt signaling pathway     105711654 (IL4)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105711654 (IL4)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     105711654 (IL4)    04660 T cell receptor signaling pathway     105711654 (IL4)    04658 Th1 and Th2 cell differentiation     105711654 (IL4)    04659 Th17 cell differentiation     105711654 (IL4)    04657 IL-17 signaling pathway     105711654 (IL4)    04664 Fc epsilon RI signaling pathway     105711654 (IL4)    04672 Intestinal immune network for IgA production     105711654 (IL4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105711654 (IL4)   09174 Infectious disease: parasitic    05140 Leishmaniasis     105711654 (IL4)   09163 Immune disease    05310 Asthma     105711654 (IL4)    05320 Autoimmune thyroid disease     105711654 (IL4)    05321 Inflammatory bowel disease     105711654 (IL4)    05330 Allograft rejection     105711654 (IL4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:anan04052]     105711654 (IL4)    00536 Glycosaminoglycan binding proteins [BR:anan00536]     105711654 (IL4) Cytokines and neuropeptides [BR:anan04052]  Cytokines   Interleukins    105711654 (IL4) Glycosaminoglycan binding proteins [BR:anan00536]  Heparan sulfate / Heparin   Cytokines    105711654 (IL4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL4 Mannosyl_trans3 DUF1907 Motif Other DBs NCBI-GeneID:  105711654 NCBI-ProteinID:  XP_012299924 Ensembl:  ENSANAG00000021885 LinkDB All DBs Position Unknown AA seq 151 aa AA seqDB search MGLTPRLLPALFFLLACAGNFVHGHNCDIALEEIIRTLNTVTEQKTLCTELTVMDTFAAS KNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHSHKQLIRSLKRLDRNLCSLAGL NSCPVKEANQTMLKDFLERLKMIMKEKYSKC NT seq 456 nt NT seq  +upstreamnt  +downstreamnt atgggtctcaccccccgactgcttcccgctctgttcttcctgttagcatgtgccggcaac tttgtccatggacacaactgcgatatcgccttagaggagatcatcagaactttgaacact gtcacagaacaaaagactctgtgcaccgagttgaccgtaatggacacctttgctgcctcc aagaacacaactgagaaggaaaccttctgcagggctgcgactgtgctccggcagttctac agccaccatgagaaggacactcgctgcctgggtgcgactgcacagcagttccacagtcac aagcagctgatccgatccctgaaacggctggacaggaacctctgcagcctggcgggcttg aactcctgtcctgtgaaggaagccaaccagactatgttgaaagacttcttggaaaggcta aagatgatcatgaaagagaaatattcaaagtgttga

DBGET integrated database retrieval system