Aotus nancymaae (Ma's night monkey): 105711998 Help Entry 105711998         CDS       T10127                                  Symbol RAP1B Name (RefSeq) ras-related protein Rap-1b   KO K07836   Ras-related protein Rap-1B Organism anan  Aotus nancymaae (Ma's night monkey) Pathway anan04010   MAPK signaling pathway anan04014   Ras signaling pathway anan04015   Rap1 signaling pathway anan04024   cAMP signaling pathway anan04062   Chemokine signaling pathway anan04510   Focal adhesion anan04520   Adherens junction anan04611   Platelet activation anan04670   Leukocyte transendothelial migration anan04720   Long-term potentiation anan04722   Neurotrophin signaling pathway anan04934   Cushing syndrome anan04972   Pancreatic secretion anan05211   Renal cell carcinoma anan05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:anan00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     105711998 (RAP1B)    04014 Ras signaling pathway     105711998 (RAP1B)    04015 Rap1 signaling pathway     105711998 (RAP1B)    04024 cAMP signaling pathway     105711998 (RAP1B)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     105711998 (RAP1B)    04520 Adherens junction     105711998 (RAP1B)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     105711998 (RAP1B)    04670 Leukocyte transendothelial migration     105711998 (RAP1B)    04062 Chemokine signaling pathway     105711998 (RAP1B)   09154 Digestive system    04972 Pancreatic secretion     105711998 (RAP1B)   09156 Nervous system    04720 Long-term potentiation     105711998 (RAP1B)    04722 Neurotrophin signaling pathway     105711998 (RAP1B)  09160 Human Diseases   09162 Cancer: specific types    05211 Renal cell carcinoma     105711998 (RAP1B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105711998 (RAP1B)   09167 Endocrine and metabolic disease    04934 Cushing syndrome     105711998 (RAP1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:anan04147]     105711998 (RAP1B)    04031 GTP-binding proteins [BR:anan04031]     105711998 (RAP1B) Exosome [BR:anan04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105711998 (RAP1B)   Exosomal proteins of other body fluids (saliva and urine)    105711998 (RAP1B)   Exosomal proteins of colorectal cancer cells    105711998 (RAP1B) GTP-binding proteins [BR:anan04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     105711998 (RAP1B) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 G-alpha Motif Other DBs NCBI-GeneID:  105711998 NCBI-ProteinID:  XP_012300327 Ensembl:  ENSANAG00000020692 UniProt:  A0A2K5C9V9 LinkDB All DBs Position Unknown AA seq 184 aa AA seqDB search MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAG TEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDL EDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSS CQLL NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgcgtgagtataagctagtcgttcttggctcaggaggtgttggaaagtctgctttgact gtacaatttgttcaaggaatttttgttgaaaaatatgatcctacgatagaagattcttat agaaagcaagttgaagtagatgcacaacagtgtatgcttgaaatcttggatactgcagga acggaacaatttacagcaatgagggatttgtacatgaaaaatgggcaaggctttgcatta gtttattccatcacggcacagtccacatttaacgatttacaagacctgagagaacagatt cttcgagttaaagacactgatgatgttccaatgattcttgttggtaataagtgtgacttg gaagatgaaagagttgtagggaaggaacaaggtcaaaatctagcaagacagtggaacaac tgtgcattcttagaatcttctgcaaaatcaaaaataaatgttaatgagatcttttatgac ctagtgcggcaaattaacagaaaaactccagtgcctgggaaggctcgcaaaaagtcgtca tgtcagctgctttaa

DBGET integrated database retrieval system