Aotus nancymaae (Ma's night monkey): 105712961 Help Entry 105712961         CDS       T10127                                  Symbol BCL2 Name (RefSeq) apoptosis regulator Bcl-2   KO K02161   apoptosis regulator Bcl-2 Organism anan  Aotus nancymaae (Ma's night monkey) Pathway anan01521   EGFR tyrosine kinase inhibitor resistance anan01522   Endocrine resistance anan01524   Platinum drug resistance anan04064   NF-kappa B signaling pathway anan04066   HIF-1 signaling pathway anan04071   Sphingolipid signaling pathway anan04115   p53 signaling pathway anan04140   Autophagy - animal anan04141   Protein processing in endoplasmic reticulum anan04151   PI3K-Akt signaling pathway anan04210   Apoptosis anan04215   Apoptosis - multiple species anan04217   Necroptosis anan04261   Adrenergic signaling in cardiomyocytes anan04340   Hedgehog signaling pathway anan04510   Focal adhesion anan04621   NOD-like receptor signaling pathway anan04630   JAK-STAT signaling pathway anan04722   Neurotrophin signaling pathway anan04725   Cholinergic synapse anan04915   Estrogen signaling pathway anan04928   Parathyroid hormone synthesis, secretion and action anan04933   AGE-RAGE signaling pathway in diabetic complications anan05014   Amyotrophic lateral sclerosis anan05022   Pathways of neurodegeneration - multiple diseases anan05132   Salmonella infection anan05145   Toxoplasmosis anan05152   Tuberculosis anan05161   Hepatitis B anan05162   Measles anan05168   Herpes simplex virus 1 infection anan05169   Epstein-Barr virus infection anan05170   Human immunodeficiency virus 1 infection anan05200   Pathways in cancer anan05206   MicroRNAs in cancer anan05207   Chemical carcinogenesis - receptor activation anan05210   Colorectal cancer anan05215   Prostate cancer anan05222   Small cell lung cancer anan05226   Gastric cancer anan05417   Lipid and atherosclerosis anan05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:anan00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     105712961 (BCL2)  09130 Environmental Information Processing   09132 Signal transduction    04340 Hedgehog signaling pathway     105712961 (BCL2)    04630 JAK-STAT signaling pathway     105712961 (BCL2)    04064 NF-kappa B signaling pathway     105712961 (BCL2)    04066 HIF-1 signaling pathway     105712961 (BCL2)    04071 Sphingolipid signaling pathway     105712961 (BCL2)    04151 PI3K-Akt signaling pathway     105712961 (BCL2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     105712961 (BCL2)   09143 Cell growth and death    04210 Apoptosis     105712961 (BCL2)    04215 Apoptosis - multiple species     105712961 (BCL2)    04217 Necroptosis     105712961 (BCL2)    04115 p53 signaling pathway     105712961 (BCL2)   09144 Cellular community - eukaryotes    04510 Focal adhesion     105712961 (BCL2)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     105712961 (BCL2)   09152 Endocrine system    04915 Estrogen signaling pathway     105712961 (BCL2)    04928 Parathyroid hormone synthesis, secretion and action     105712961 (BCL2)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     105712961 (BCL2)   09156 Nervous system    04725 Cholinergic synapse     105712961 (BCL2)    04722 Neurotrophin signaling pathway     105712961 (BCL2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105712961 (BCL2)    05206 MicroRNAs in cancer     105712961 (BCL2)    05207 Chemical carcinogenesis - receptor activation     105712961 (BCL2)   09162 Cancer: specific types    05210 Colorectal cancer     105712961 (BCL2)    05226 Gastric cancer     105712961 (BCL2)    05215 Prostate cancer     105712961 (BCL2)    05222 Small cell lung cancer     105712961 (BCL2)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     105712961 (BCL2)    05161 Hepatitis B     105712961 (BCL2)    05162 Measles     105712961 (BCL2)    05168 Herpes simplex virus 1 infection     105712961 (BCL2)    05169 Epstein-Barr virus infection     105712961 (BCL2)   09171 Infectious disease: bacterial    05132 Salmonella infection     105712961 (BCL2)    05152 Tuberculosis     105712961 (BCL2)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     105712961 (BCL2)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     105712961 (BCL2)    05022 Pathways of neurodegeneration - multiple diseases     105712961 (BCL2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105712961 (BCL2)    05418 Fluid shear stress and atherosclerosis     105712961 (BCL2)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     105712961 (BCL2)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     105712961 (BCL2)    01524 Platinum drug resistance     105712961 (BCL2)    01522 Endocrine resistance     105712961 (BCL2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:anan01009]     105712961 (BCL2) Protein phosphatases and associated proteins [BR:anan01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      105712961 (BCL2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 ARMH5 Motif Other DBs NCBI-GeneID:  105712961 NCBI-ProteinID:  XP_012301848 Ensembl:  ENSANAG00000032927 UniProt:  A0A2K5EB04 LinkDB All DBs Position Unknown AA seq 240 aa AA seqDB search MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPGPA APRDPVSRTSPPPPPAAPAAAATGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQL HLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTE YLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK NT seq 723 nt NT seq  +upstreamnt  +downstreamnt atggcgcacgctgggagaacagggtacgataaccgagagatagtgatgaagtacatccac tataagctgtcgcagaggggctacgagtgggatgccggagatgtgggcgccgcaccccca ggggccgcccccgcgccgggcatcttctcctcccagcctggacacacgcccggtcccgcc gcgccccgggacccggtctccaggacctcgccgccgccgcccccggccgcccccgccgcc gccgccacggggcctgcgctcagcccggtgccacctgtggtccacctgaccctccgccag gccggggacgacttctcccgccgctaccgccgcgacttcgccgagatgtccagccagctg cacctgacgcccttcaccgcgcggggacgctttgccacggtggtggaggagctcttcagg gacggggtgaactgggggaggattgtggccttctttgagttcggtggggtcatgtgtgtg gagagcgtcaaccgggagatgtcgcccctggtggacaacatcgccctgtggatgaccgag tacctgaaccggcacctgcacacctggatccaggataacggaggctgggatgcctttgtg gaactgtatggccccagcatgcggcctctgtttgatttctcctggctgtctctgaagact ctgctcagcttggccctggtgggagcttgcatcaccctgggtgcctatctgggccacaag tga

DBGET integrated database retrieval system