Aotus nancymaae (Ma's night monkey): 105715622 Help Entry 105715622         CDS       T10127                                  Symbol IFNB1 Name (RefSeq) interferon beta   KO K05415   interferon beta Organism anan  Aotus nancymaae (Ma's night monkey) Pathway anan04060   Cytokine-cytokine receptor interaction anan04151   PI3K-Akt signaling pathway anan04217   Necroptosis anan04380   Osteoclast differentiation anan04620   Toll-like receptor signaling pathway anan04621   NOD-like receptor signaling pathway anan04622   RIG-I-like receptor signaling pathway anan04623   Cytosolic DNA-sensing pathway anan04630   JAK-STAT signaling pathway anan04650   Natural killer cell mediated cytotoxicity anan04668   TNF signaling pathway anan04936   Alcoholic liver disease anan05135   Yersinia infection anan05142   Chagas disease anan05152   Tuberculosis anan05160   Hepatitis C anan05161   Hepatitis B anan05162   Measles anan05163   Human cytomegalovirus infection anan05164   Influenza A anan05165   Human papillomavirus infection anan05167   Kaposi sarcoma-associated herpesvirus infection anan05168   Herpes simplex virus 1 infection anan05169   Epstein-Barr virus infection anan05170   Human immunodeficiency virus 1 infection anan05171   Coronavirus disease - COVID-19 anan05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:anan00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     105715622 (IFNB1)    04668 TNF signaling pathway     105715622 (IFNB1)    04151 PI3K-Akt signaling pathway     105715622 (IFNB1)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105715622 (IFNB1)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     105715622 (IFNB1)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     105715622 (IFNB1)    04621 NOD-like receptor signaling pathway     105715622 (IFNB1)    04622 RIG-I-like receptor signaling pathway     105715622 (IFNB1)    04623 Cytosolic DNA-sensing pathway     105715622 (IFNB1)    04650 Natural killer cell mediated cytotoxicity     105715622 (IFNB1)   09158 Development and regeneration    04380 Osteoclast differentiation     105715622 (IFNB1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     105715622 (IFNB1)    05161 Hepatitis B     105715622 (IFNB1)    05160 Hepatitis C     105715622 (IFNB1)    05171 Coronavirus disease - COVID-19     105715622 (IFNB1)    05164 Influenza A     105715622 (IFNB1)    05162 Measles     105715622 (IFNB1)    05168 Herpes simplex virus 1 infection     105715622 (IFNB1)    05163 Human cytomegalovirus infection     105715622 (IFNB1)    05167 Kaposi sarcoma-associated herpesvirus infection     105715622 (IFNB1)    05169 Epstein-Barr virus infection     105715622 (IFNB1)    05165 Human papillomavirus infection     105715622 (IFNB1)   09171 Infectious disease: bacterial    05135 Yersinia infection     105715622 (IFNB1)    05152 Tuberculosis     105715622 (IFNB1)   09174 Infectious disease: parasitic    05142 Chagas disease     105715622 (IFNB1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105715622 (IFNB1)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     105715622 (IFNB1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:anan04052]     105715622 (IFNB1) Cytokines and neuropeptides [BR:anan04052]  Cytokines   Interferons    105715622 (IFNB1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  105715622 NCBI-ProteinID:  XP_012305452 LinkDB All DBs Position Unknown AA seq 187 aa AA seqDB search MTHQCLLQIALLLCFSTTAISMNYNLLGFLQRRSNFQSQKLLWQLNGRLEDCLKDRMNFE VPKELTQPQQLQKEDAALIVYEMLQNIFTIFRRDFSRTGWNETIVENLLANVYQQAEHLK TILQEKWEEKEFTTGKFMISLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINR LTGYLRN NT seq 564 nt NT seq  +upstreamnt  +downstreamnt atgacccaccagtgtctcctccaaattgctctcctgttgtgcttctccactacagctatt tccatgaactacaacttgcttggattcctacaaagaagaagcaattttcagagtcagaag ctcctgtggcaattgaatggaaggcttgaagattgcctcaaggacaggatgaactttgag gtccctaaggagctcacacaaccgcagcagctccagaaggaggacgcggcattaatcgtc tatgagatgctccagaacatctttactattttcagaagagatttctctaggactggctgg aatgagactattgttgagaacctccttgctaatgtctatcagcaagcagaacatctgaag acaatcctacaagaaaaatgggaggaaaaagaattcaccacgggaaaattcatgatcagt ctgcacctgaaaagatattatgggaggattctgcattacctgaaggccaaggagtacagc cactgtgcctggaccatagtcagagtggaaatcctcaggaacttttactttattaacaga cttacaggttacctccgaaactga

DBGET integrated database retrieval system