Aotus nancymaae (Ma's night monkey): 105716995 Help Entry 105716995         CDS       T10127                                  Name (RefSeq) E3 ubiquitin-protein ligase RBX1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism anan  Aotus nancymaae (Ma's night monkey) Pathway anan03420   Nucleotide excision repair anan04066   HIF-1 signaling pathway anan04110   Cell cycle anan04114   Oocyte meiosis anan04120   Ubiquitin mediated proteolysis anan04141   Protein processing in endoplasmic reticulum anan04310   Wnt signaling pathway anan04350   TGF-beta signaling pathway anan04710   Circadian rhythm anan05170   Human immunodeficiency virus 1 infection anan05200   Pathways in cancer anan05211   Renal cell carcinoma Brite KEGG Orthology (KO) [BR:anan00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     105716995    04120 Ubiquitin mediated proteolysis     105716995   09124 Replication and repair    03420 Nucleotide excision repair     105716995  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     105716995    04350 TGF-beta signaling pathway     105716995    04066 HIF-1 signaling pathway     105716995  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     105716995    04114 Oocyte meiosis     105716995  09150 Organismal Systems   09159 Environmental adaptation    04710 Circadian rhythm     105716995  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105716995   09162 Cancer: specific types    05211 Renal cell carcinoma     105716995   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     105716995  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:anan04121]     105716995    03400 DNA repair and recombination proteins [BR:anan03400]     105716995 Enzymes [BR:anan01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      105716995 Ubiquitin system [BR:anan04121]  Ubiquitin ligases (E3)   UBL E3 ligases    105716995   Multi subunit type E3    SCF complex     Ring finger protein      105716995    Cul2 complex      105716995    Cul3 complex      105716995    Cul4 complex      105716995    Cul7 complex      105716995    Cul8 complex      105716995    Cul9 complex      105716995 DNA repair and recombination proteins [BR:anan03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       105716995     TCR (transcription coupled repair) factors      Cul4-CSA complex       105716995 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 PHD_NSD Motif Other DBs NCBI-GeneID:  105716995 NCBI-ProteinID:  XP_012307328 Ensembl:  ENSANAG00000019395 UniProt:  A0A2K5C2T6 LinkDB All DBs Position Unknown AA seq 108 aa AA seqDB search MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggcggcagcgatggatgtggataccccgagcggcaccaacagcggcgcgggcaagaag cgctttgaagtgaaaaagtggaatgcagtagccctctgggcctgggatattgtggttgat aactgtgccatctgcaggaaccacattatggatctttgcatagaatgtcaagctaaccag gcgtccgctacttcagaagagtgtaccgttgcatggggagtctgtaaccacgcttttcac ttccactgcatctctcgctggctcaaaacacgacaagtgtgtccgttggacaacagagag tgggaattccaaaagtatgggcactag

DBGET integrated database retrieval system