Aotus nancymaae (Ma's night monkey): 105718625 Help Entry 105718625         CDS       T10127                                  Symbol TMEM258 Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism anan  Aotus nancymaae (Ma's night monkey) Pathway anan00510   N-Glycan biosynthesis anan00513   Various types of N-glycan biosynthesis anan04141   Protein processing in endoplasmic reticulum Module anan_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:anan00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     105718625 (TMEM258)    00513 Various types of N-glycan biosynthesis     105718625 (TMEM258)  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     105718625 (TMEM258) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ost5 DUF6512 TctB Phage_holin_3_3 Motif Other DBs NCBI-GeneID:  105718625 NCBI-ProteinID:  XP_012309820 Ensembl:  ENSANAG00000035195 UniProt:  A0A2K5EPZ6 LinkDB All DBs Position Unknown AA seq 79 aa AA seqDB search MELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVA SLFMGFGVLFLLLWVGIYV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggagctcgaggccatgagcagatacaccagcccagtgaacccagctgtcttcccccat ctgaccgtggtgcttttggccatcggcatgttcttcactgcctggttcttcgtttacgag gtcacctctaccaagtacactcgtgatatctataaagagctcctcatctccttggtggcc tcactcttcatgggctttggagtcctcttcctgctgctctgggtcggcatctatgtgtga

DBGET integrated database retrieval system