Aotus nancymaae (Ma's night monkey): 105725175 Help Entry 105725175         CDS       T10127                                  Symbol MAX Name (RefSeq) protein max isoform X1   KO K04453   Max protein Organism anan  Aotus nancymaae (Ma's night monkey) Pathway anan03083   Polycomb repressive complex anan04010   MAPK signaling pathway anan05200   Pathways in cancer anan05202   Transcriptional misregulation in cancer anan05222   Small cell lung cancer Brite KEGG Orthology (KO) [BR:anan00001]  09120 Genetic Information Processing   09126 Chromosome    03083 Polycomb repressive complex     105725175 (MAX)  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     105725175 (MAX)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105725175 (MAX)    05202 Transcriptional misregulation in cancer     105725175 (MAX)   09162 Cancer: specific types    05222 Small cell lung cancer     105725175 (MAX)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:anan03000]     105725175 (MAX)    03036 Chromosome and associated proteins [BR:anan03036]     105725175 (MAX) Transcription factors [BR:anan03000]  Eukaryotic type   Basic helix-loop-helix/leucine zipper (bHLH-ZIP)    Cell cycle controlling factors, Mad/Max     105725175 (MAX) Chromosome and associated proteins [BR:anan03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.6)      105725175 (MAX) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  HLH JetA Filament bZIP_2 bHLH_INO4 SlyX bHLH_INO2 SLX9 GAGA_bind DUF7801 DUF4763 XhlA Csm1_N ATG16 Motif Other DBs NCBI-GeneID:  105725175 NCBI-ProteinID:  XP_012319577 Ensembl:  ENSANAG00000027631 UniProt:  A0A2K5DFM1 LinkDB All DBs Position Unknown AA seq 160 aa AA seqDB search MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASR AQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKARSSAQLQTNYPSSDN SLYTNAKGSTISAFDGGSDSSSESEPEEPQSRKKLRMEAT NT seq 483 nt NT seq  +upstreamnt  +downstreamnt atgagcgataacgatgacatcgaggtggagagcgacgaagagcaaccgaggtttcaatct gcggctgacaaacgggctcatcataatgcactggaacgaaaacgtagggaccacatcaaa gacagctttcacagtttacgggactcagtcccatcactccaaggagagaaggcatcccgg gcccaaatcctagacaaagccacagagtatatccagtatatgcgaaggaaaaaccacaca caccagcaagatattgacgacctcaagcggcagaatgctcttctggagcagcaagtccgt gcactggagaaggcgaggtcaagtgcccaactgcagaccaactacccctcctcagacaac agcctctacaccaacgccaagggcagcaccatctctgccttcgatgggggctcagactcc agctcagagtctgagcctgaagagccccaaagcaggaagaagctccggatggaggccacc taa

DBGET integrated database retrieval system