Aotus nancymaae (Ma's night monkey): 105725381 Help Entry 105725381         CDS       T10127                                  Name (RefSeq) C-X-C motif chemokine 2   KO K05505   C-X-C motif chemokine 1/2/3 Organism anan  Aotus nancymaae (Ma's night monkey) Pathway anan04060   Cytokine-cytokine receptor interaction anan04061   Viral protein interaction with cytokine and cytokine receptor anan04062   Chemokine signaling pathway anan04064   NF-kappa B signaling pathway anan04621   NOD-like receptor signaling pathway anan04657   IL-17 signaling pathway anan04668   TNF signaling pathway anan04936   Alcoholic liver disease anan05134   Legionellosis anan05146   Amoebiasis anan05167   Kaposi sarcoma-associated herpesvirus infection anan05323   Rheumatoid arthritis anan05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:anan00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     105725381    04668 TNF signaling pathway     105725381   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105725381    04061 Viral protein interaction with cytokine and cytokine receptor     105725381  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     105725381    04657 IL-17 signaling pathway     105725381    04062 Chemokine signaling pathway     105725381  09160 Human Diseases   09172 Infectious disease: viral    05167 Kaposi sarcoma-associated herpesvirus infection     105725381   09171 Infectious disease: bacterial    05134 Legionellosis     105725381   09174 Infectious disease: parasitic    05146 Amoebiasis     105725381   09163 Immune disease    05323 Rheumatoid arthritis     105725381   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105725381   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     105725381  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:anan04052]     105725381 Cytokines and neuropeptides [BR:anan04052]  Cytokines   Chemokines    105725381 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  105725381 NCBI-ProteinID:  XP_012319820 Ensembl:  ENSANAG00000027346 UniProt:  A0A2K5DDK4 LinkDB All DBs Position Unknown AA seq 107 aa AA seqDB search MAHAALSADSSNPRLLRAALLLLLLVVAGRRAAGAPLANELRCHCLQTLQGIHLKNIQSV EVKQPGPHCDQTEVIATLKNGQKACLNPASPMVKKIIEKILNSGKSN NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atggcccacgccgcgctctccgccgactccagcaacccccggctcctgcgggcggcgctg ctactcctgctcctggtggtcgccggccggcgcgcggcaggagcgcccctggccaatgaa ctgcgctgccattgtctgcagaccctgcagggaattcacctcaagaacatccaaagtgtg gaagtgaagcaaccgggaccccactgcgaccaaaccgaagtcatagccacactcaagaat gggcagaaagcttgtctgaaccccgcatcccccatggttaagaaaatcatcgaaaagatt ctgaacagtggcaaatccaactga

DBGET integrated database retrieval system