Ancylobacter sp. TS-1: GBB76_00720 Help Entry GBB76_00720       CDS       T06239                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism anc  Ancylobacter sp. TS-1 Pathway anc00790   Folate biosynthesis anc01100   Metabolic pathways anc01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:anc00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     GBB76_00720 (folB) Enzymes [BR:anc01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      GBB76_00720 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      GBB76_00720 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      GBB76_00720 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  QFR31751 UniProt:  A0A5P8MT98 LinkDB All DBs Position complement(142430..142792) Genome browser AA seq 120 aa AA seqDB search MSDRIFLRGVELHAHHGLHPEEARLGQRFIVDIDWWLDTGPAAAHDNYSETVGYEKVFEV IHEVSSGHRFHILEAFAQAIADAVLARYPRVEKVRVEIHKPAAPIAGIFRDAGVDITRTR NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atgtccgatcgtatcttcctccgaggcgtcgaactgcacgcccatcacggcctgcatccc gaggaggcgcggctcggccagcgtttcatcgtcgacatcgactggtggctggacaccggg ccggccgccgcgcacgacaattacagcgagaccgtcggctatgagaaggtgttcgaggtc atccacgaggtctcctccggccaccgcttccacattctggaagccttcgcccaggccatc gcggatgccgtgctcgcgcgctatccgcgcgtcgagaaggtgcgcgtggaaatccacaag cctgccgccccgatcgccggcatcttccgcgacgccggtgtcgacatcacccgcacgcgc tga

DBGET integrated database retrieval system