Aspergillus niger (black aspergilli): An17g02100 Help Entry An17g02100        CDS       T01030                                  Name (RefSeq) uncharacterized protein   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism ang  Aspergillus niger (black aspergilli) Pathway ang03420   Nucleotide excision repair ang04111   Cell cycle - yeast ang04120   Ubiquitin mediated proteolysis ang04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:ang00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     An17g02100    04120 Ubiquitin mediated proteolysis     An17g02100   09124 Replication and repair    03420 Nucleotide excision repair     An17g02100  09140 Cellular Processes   09143 Cell growth and death    04111 Cell cycle - yeast     An17g02100  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:ang04121]     An17g02100    03400 DNA repair and recombination proteins [BR:ang03400]     An17g02100 Enzymes [BR:ang01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      An17g02100 Ubiquitin system [BR:ang04121]  Ubiquitin ligases (E3)   UBL E3 ligases    An17g02100   Multi subunit type E3    SCF complex     Ring finger protein      An17g02100    Cul2 complex      An17g02100    Cul3 complex      An17g02100    Cul4 complex      An17g02100    Cul7 complex      An17g02100    Cul8 complex      An17g02100    Cul9 complex      An17g02100 DNA repair and recombination proteins [BR:ang03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       An17g02100     TCR (transcription coupled repair) factors      Cul4-CSA complex       An17g02100 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 PHD_NSD Motif Other DBs NCBI-GeneID:  4989533 NCBI-ProteinID:  XP_001398439 UniProt:  A0A254U597 A2R9P0 LinkDB All DBs Position V AA seq 119 aa AA seqDB search MADVEMKEAGSAAVKAKGSSKASEGASDGKKKFEVKKWNAVALWAWDIVVDNCAICRNHI MDLCIECQANQGSSTTEECTVAWGICNHAFHFHCISRWLKTRQVCPLDNRDWEFQKYGR NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggcggatgtggaaatgaaagaagccggctccgccgccgtcaaagcgaagggctcatcg aaagcttccgaaggtgccagtgacggcaagaagaagtttgaggttaagaagtggaacgcg gtcgccctgtgggcgtgggatatcgtcgtcgacaactgcgcaatttgccgtaaccacatc atggatctctgtatcgagtgccaagccaaccaaggttcgtctacgactgaggagtgtaca gtcgcttggggtatctgcaaccacgcgttccacttccactgcatctcgcgatggctgaaa acccgtcaagtttgtcccctcgacaatagggactgggagttccagaagtacggccggtaa

DBGET integrated database retrieval system