Andrographis paniculata: 127264161 Help Entry 127264161         CDS       T08689                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism apan  Andrographis paniculata Pathway apan03420   Nucleotide excision repair apan04120   Ubiquitin mediated proteolysis apan04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:apan00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     127264161    04120 Ubiquitin mediated proteolysis     127264161   09124 Replication and repair    03420 Nucleotide excision repair     127264161  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:apan04121]     127264161    03400 DNA repair and recombination proteins [BR:apan03400]     127264161 Enzymes [BR:apan01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      127264161 Ubiquitin system [BR:apan04121]  Ubiquitin ligases (E3)   UBL E3 ligases    127264161   Multi subunit type E3    SCF complex     Ring finger protein      127264161    Cul2 complex      127264161    Cul3 complex      127264161    Cul4 complex      127264161    Cul7 complex      127264161    Cul8 complex      127264161    Cul9 complex      127264161 DNA repair and recombination proteins [BR:apan03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       127264161     TCR (transcription coupled repair) factors      Cul4-CSA complex       127264161 SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  127264161 NCBI-ProteinID:  XP_051149546 LinkDB All DBs Position Unknown AA seq 124 aa AA seqDB search MASLDSDVNMVPAGEGSSAAGPSTGNPSSSSSKKAKRFEIKKWNAVALWAWDIVVDNCAI CRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQ KYGH NT seq 375 nt NT seq  +upstreamnt  +downstreamnt atggcatctctcgattccgacgtgaatatggttcccgccggcgagggatcgtccgccgcg ggtccttccaccggtaatccgtcctcctcctcctccaagaaagcgaagcgattcgagatc aagaaatggaacgccgtcgctctgtgggcttgggatatcgtggtcgataattgtgcgatt tgcaggaatcatattatggatctctgcatcgagtgtcaggcgaatcaagctagtgctacg agtgaagaatgcacagttgcttggggtgtttgcaaccatgctttccattttcactgcatc agcagatggctgaaaacccgtcaagtctgccctcttgataacagcgagtgggagtttcag aagtatggccactag

DBGET integrated database retrieval system