Anaeromyxobacter paludicola: AMPC_17350 Help Entry AMPC_17350        CDS       T08525                                  Name (GenBank) hypothetical protein   KO K01737   6-pyruvoyltetrahydropterin/6-carboxytetrahydropterin synthase [EC:4.2.3.12 4.1.2.50] Organism apau  Anaeromyxobacter paludicola Pathway apau00790   Folate biosynthesis apau01100   Metabolic pathways apau01240   Biosynthesis of cofactors Module apau_M00988   PreQ1 biosynthesis, GTP => 7-Aminomethyl-7-deazaguanine Brite KEGG Orthology (KO) [BR:apau00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     AMPC_17350  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03016 Transfer RNA biogenesis [BR:apau03016]     AMPC_17350 Enzymes [BR:apau01000]  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.50  6-carboxytetrahydropterin synthase      AMPC_17350   4.2  Carbon-oxygen lyases    4.2.3  Acting on phosphates     4.2.3.12  6-pyruvoyltetrahydropterin synthase      AMPC_17350 Transfer RNA biogenesis [BR:apau03016]  Prokaryotic type   tRNA modification factors    Other tRNA modification factors     AMPC_17350 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PTPS Motif Other DBs NCBI-ProteinID:  BDG08622 LinkDB All DBs Position complement(1922906..1923121) Genome browser AA seq 71 aa AA seqDB search MDFGDIKKAFQPLLDRLDHYYLNEVDGLENPTSEVLARWIWRRLKPGLPLLSEIVVRETC TSGCIYRGEEE NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atggacttcggcgatatcaagaaggcgttccagcctctgctggacaggctcgaccactac tatctcaacgaggttgacggcctcgagaaccccacgagcgaggtgctggcgcgctggatc tggcgtcgtttgaagcccggacttccgcttctgtccgagatcgtcgttcgtgagacatgc acttcgggctgcatctaccgcggggaggaggagtga

DBGET integrated database retrieval system