Acyrthosiphon pisum (pea aphid): 103310010 Help Entry 103310010         CDS       T01076                                  Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism api  Acyrthosiphon pisum (pea aphid) Pathway api00510   N-Glycan biosynthesis api00513   Various types of N-glycan biosynthesis api04141   Protein processing in endoplasmic reticulum Module api_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:api00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     103310010    00513 Various types of N-glycan biosynthesis     103310010  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     103310010 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ost5 Motif Other DBs NCBI-GeneID:  103310010 NCBI-ProteinID:  XP_008185193 UniProt:  A0A8R2FA24 LinkDB All DBs Position A1:124441315..124444127 Genome browser AA seq 77 aa AA seqDB search MTLYKRYVSPVSPAVYPHLTLLLLSIGVFFTAWFFVYEVTGTKYTRNLKKELTISFVAAL FTGFGLLFLLLWVGIYV NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgacactgtacaagcggtatgtgtctccagttagcccagcagtttatccacacctcact ttgttattgctcagcattggtgtgtttttcacggcatggtttttcgtctatgaagttact ggtacaaagtataccagaaatttgaaaaaagaactgacgatatcttttgttgccgcctta tttactggctttggtcttctattcttattactatgggttggaatatatgtataa

DBGET integrated database retrieval system