Anas platyrhynchos (mallard): 101790439 Help Entry 101790439         CDS       T02816                                  Symbol IFNG Name (RefSeq) interferon gamma precursor   KO K04687   interferon gamma Organism apla  Anas platyrhynchos (mallard) Pathway apla03050   Proteasome apla04060   Cytokine-cytokine receptor interaction apla04217   Necroptosis apla04350   TGF-beta signaling pathway apla05164   Influenza A apla05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:apla00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     101790439 (IFNG)  09130 Environmental Information Processing   09132 Signal transduction    04350 TGF-beta signaling pathway     101790439 (IFNG)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101790439 (IFNG)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     101790439 (IFNG)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     101790439 (IFNG)    05168 Herpes simplex virus 1 infection     101790439 (IFNG)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03051 Proteasome [BR:apla03051]     101790439 (IFNG)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:apla04052]     101790439 (IFNG)    00536 Glycosaminoglycan binding proteins [BR:apla00536]     101790439 (IFNG) Proteasome [BR:apla03051]  Eukaryotic proteasome   Assembling factors    Other assembling factors     101790439 (IFNG) Cytokines and neuropeptides [BR:apla04052]  Cytokines   Interferons    101790439 (IFNG) Glycosaminoglycan binding proteins [BR:apla00536]  Heparan sulfate / Heparin   Cytokines    101790439 (IFNG) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IFN-gamma Sec20 DUF6712 Motif Other DBs NCBI-GeneID:  101790439 NCBI-ProteinID:  NP_001297346 Ensembl:  ENSAPLG00000012876 UniProt:  Q9YGB9 Q0MRR0 LinkDB All DBs Position 1:complement(37182316..37194448) Genome browser AA seq 164 aa AA seqDB search MTCQTYCLFVLSVIMIYFGCSGSALFLGQLQNDIDKLKADFNASNSDVADGNPVFIEKVK NWTERNEKRIILSQIVTLYLEMLKKTDMSKPHIKNLSEQLNTLRNTLSNDYKKFRDLVEL SNLQLTGLKIQRKAVSELFSVLQKLVETSTSKRKRSQSPKRCRC NT seq 495 nt NT seq  +upstreamnt  +downstreamnt atgacttgccagacctactgcttgtttgttctctctgtcatcatgatttattttggatgt tctggaagtgctttatttctaggtcaacttcaaaatgacatagacaaactgaaagctgat tttaatgcaagtaattcggatgtagctgatggcaatcctgtttttatagagaaagtgaaa aactggacagagagaaatgaaaaaaggatcatactgagccagattgttaccctgtacttg gaaatgctaaagaaaactgacatgtcaaagccacacatcaaaaatttatctgagcagctc aatactctgagaaataccctttccaatgactacaagaagttcagagacctcgtggaactg tcaaaccttcagctgactggcttgaaaatccaacgcaaggctgtgagtgagctgttcagt gtcttacagaaactggtggagacttcgacttccaaaaggaaaaggagccagtctccaaag agatgcagatgttaa

DBGET integrated database retrieval system