Anas platyrhynchos (mallard): 101792342 Help Entry 101792342         CDS       T02816                                  Symbol CXCL12 Name (RefSeq) stromal cell-derived factor 1   KO K10031   C-X-C motif chemokine 12 Organism apla  Anas platyrhynchos (mallard) Pathway apla04060   Cytokine-cytokine receptor interaction apla04672   Intestinal immune network for IgA production apla04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:apla00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101792342 (CXCL12)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     101792342 (CXCL12)  09150 Organismal Systems   09151 Immune system    04672 Intestinal immune network for IgA production     101792342 (CXCL12)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:apla04052]     101792342 (CXCL12)    00536 Glycosaminoglycan binding proteins [BR:apla00536]     101792342 (CXCL12) Cytokines and neuropeptides [BR:apla04052]  Cytokines   Chemokines    101792342 (CXCL12) Glycosaminoglycan binding proteins [BR:apla00536]  Heparan sulfate / Heparin   Chemokines    101792342 (CXCL12) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  101792342 NCBI-ProteinID:  XP_027315681 UniProt:  A0A8B9ZHI3 LinkDB All DBs Position 6:complement(19360255..19377901) Genome browser AA seq 131 aa AA seqDB search MELRALALLAFALALVSLSEEKPVSLTYRCPCRFYESNVARANIKHLKILSTPNCSLQIV ARLKSNSKQVCIDPKLKWIQEYLEKALNKPRHRTHKKKQQKKRGPLCPSRATPLKSPGRK NGGSRCKRQAL NT seq 396 nt NT seq  +upstreamnt  +downstreamnt atggagctccgcgccctcgccctgctcgccttcgccctggccctcgtctccctctcggag gagaaacccgtcagcctgacttaccgatgtccctgtcgattctacgagagcaacgtggcc agagccaacattaagcacctcaaaatcctctccacccccaactgctcacttcagattgtt gcaaggcttaagagcaacagcaagcaagtgtgcattgatcccaagctaaagtggatccag gaatatctggagaaagctttaaacaaaccacgtcatcgcactcataaaaaaaagcaacag aagaaacggggcccactctgcccttcccgtgcaacaccactaaagtctccagggagaaag aatggaggttcaagatgtaagaggcaagcattgtaa

DBGET integrated database retrieval system