Anas platyrhynchos (mallard): 101805199 Help Entry 101805199         CDS       T02816                                  Name (RefSeq) hepatic lectin   KO K06563   C-type lectin domain family 4 member L/M Organism apla  Anas platyrhynchos (mallard) Pathway apla03260   Virion - Human immunodeficiency virus apla03264   Virion - Flavivirus and Alphavirus apla03265   Virion - Ebolavirus, Lyssavirus and Morbillivirus apla03273   Virion - Lassa virus and SFTS virus apla04145   Phagocytosis apla04517   IgSF CAM signaling apla04625   C-type lectin receptor signaling pathway Brite KEGG Orthology (KO) [BR:apla00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03260 Virion - Human immunodeficiency virus     101805199    03264 Virion - Flavivirus and Alphavirus     101805199    03265 Virion - Ebolavirus, Lyssavirus and Morbillivirus     101805199    03273 Virion - Lassa virus and SFTS virus     101805199  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     101805199  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     101805199  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     101805199  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:apla04131]     101805199   09183 Protein families: signaling and cellular processes    04054 Pattern recognition receptors [BR:apla04054]     101805199    04515 Cell adhesion molecules [BR:apla04515]     101805199    04090 CD molecules [BR:apla04090]     101805199    04091 Lectins [BR:apla04091]     101805199 Membrane trafficking [BR:apla04131]  Endocytosis   Phagocytosis    C-lectin receptors     101805199 Pattern recognition receptors [BR:apla04054]  Membrane-bound pattern recognition receptors   C-type lectin receptors    101805199 Cell adhesion molecules [BR:apla04515]  Lectins   Selectins and C-type lectins    101805199 CD molecules [BR:apla04090]  Proteins   101805199 Lectins [BR:apla04091]  C-Type lectins   Asialoglycoprotein and DC receptors    101805199 SSDB OrthologParalogGFIT Motif Pfam:  Lectin_C Motif Other DBs NCBI-GeneID:  101805199 NCBI-ProteinID:  XP_005018278 Ensembl:  ENSAPLG00000014336 LinkDB All DBs Position Unknown AA seq 208 aa AA seqDB search MDEEHLHDDLHIFKDRSFFQQKLRSFLTIYLLLALSFLLMITLFAVSLSRVSAISSKLNE VHTEKKQNFSNRDSLLFPCGPEAREWEYFDGKCYYFSIDRMSWYKAKTQCEEMHSRLAII NSFAKQNFVMFRTRNERFWIGLTDGNSEGEWEWIDGTDYKSTFTFWKEGEPNNSGNNEDC AHVWTSGQWNDVYCTFECYYLCEKPVPN NT seq 627 nt NT seq  +upstreamnt  +downstreamnt atggatgaggaacatctccacgatgacctgcacatctttaaagacagaagcttcttccag cagaagctgaggtcctttctcacgatttaccttctgctggcgctctccttcttgctgatg atcaccttgttcgccgtgtcgctctccagagtttctgccatctcttctaaactcaacgag gtgcacacggagaagaaacagaacttttccaacagggattccctcttgtttccctgtgga cccgaagccagggagtgggaatatttcgatggcaaatgctactacttctccatcgacaga atgagctggtacaaggcaaagacccagtgcgaggagatgcactcgcgcctggccatcatt aacagcttcgccaagcagaattttgtcatgttcaggacaaggaatgagcgcttctggatt gggctgacggacgggaactcggaaggggagtgggaatggatcgacggcaccgactacaag agcacgttcacattctggaaggaaggcgagcccaacaacagcggcaacaacgaggactgc gcccacgtctggacctccgggcagtggaacgacgtctactgcaccttcgagtgctactac ctctgcgaaaagcctgtgcccaactga

DBGET integrated database retrieval system