Arcobacter porcinus: APORC_0274 Help Entry APORC_0274        CDS       T06395                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism apoc  Arcobacter porcinus Pathway apoc00790   Folate biosynthesis apoc01100   Metabolic pathways apoc01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:apoc00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     APORC_0274 (folB) Enzymes [BR:apoc01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      APORC_0274 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      APORC_0274 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      APORC_0274 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  QEP39905 UniProt:  A0A1C0B0U5 LinkDB All DBs Position complement(242289..242600) Genome browser AA seq 103 aa AA seqDB search MKISIKKLTFKSIIGILDFERKNKQKVIVNLSFEYDFKDDEFINYAEVSKLIKTKMKKEK YYLLEDAIKELSSLLYEKYNIRNLKLKISKPDILKDCIVSLSL NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgaaaatatctataaaaaaacttactttcaaatccataattggtattttggattttgaa agaaaaaacaaacaaaaagttattgtcaatttaagctttgagtatgattttaaagatgat gaatttataaattatgcagaagtttctaaattaataaaaactaaaatgaaaaaagagaaa tactatcttcttgaagatgcaataaaagagctaagctctttactatatgaaaaatataat ataagaaatctaaaattaaaaatatcaaaaccagatattttaaaagattgtattgtatct ttatctttataa

DBGET integrated database retrieval system