Auxenochlorella protothecoides: F751_6626 Help Entry F751_6626         CDS       T04132                                  Name (RefSeq) E3 ubiquitin-protein ligase RBX1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism apro  Auxenochlorella protothecoides Pathway apro03420   Nucleotide excision repair apro04120   Ubiquitin mediated proteolysis apro04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:apro00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     F751_6626    04120 Ubiquitin mediated proteolysis     F751_6626   09124 Replication and repair    03420 Nucleotide excision repair     F751_6626  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:apro04121]     F751_6626    03400 DNA repair and recombination proteins [BR:apro03400]     F751_6626 Enzymes [BR:apro01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      F751_6626 Ubiquitin system [BR:apro04121]  Ubiquitin ligases (E3)   UBL E3 ligases    F751_6626   Multi subunit type E3    SCF complex     Ring finger protein      F751_6626    Cul2 complex      F751_6626    Cul3 complex      F751_6626    Cul4 complex      F751_6626    Cul7 complex      F751_6626    Cul8 complex      F751_6626    Cul9 complex      F751_6626 DNA repair and recombination proteins [BR:apro03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       F751_6626     TCR (transcription coupled repair) factors      Cul4-CSA complex       F751_6626 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-C3HC4_2 zf-RING_2 zf-ANAPC11 zf-C3HC4 zf-RING_UBOX zf-RING_5 zf-C3HC4_3 zf-RING_16 zf-RING_Vps41 Prok-RING_4 zf-RING_11 zf-Nse zf-RING-like zf-C3HC4_4 PHD_NSD zf-RING_4 zf_RING_Vps8 Rtf2 zinc_ribbon_16 zf-RING_10 zf-C3H2C3 zf_RING_Vps8_fungal Zf_2nd_IFT121 Motif Other DBs NCBI-GeneID:  23618017 NCBI-ProteinID:  XP_011399607 UniProt:  A0A087SLR5 LinkDB All DBs Position Unknown AA seq 124 aa AA seqDB search LQVDPTTVEEAEEKEKQVKPKSGEKRFVIKKWNAVAMWSWAICTDTCAICRNNLYEPSIE YQANPSGDPDHPGLSIAWGSCGHVFHLDCIQRWLKTRSACPLCNKEWEFSKIEKILPGGT AGTD NT seq 375 nt NT seq  +upstreamnt  +downstreamnt ctgcaggttgatcccacgacggtggaagaggcagaggagaaggagaagcaggtcaagcca aagtccggcgagaaacgcttcgtcatcaagaaatggaacgcagtcgcaatgtggtcctgg gccatctgcacggacacatgtgccatttgccggaataacctttacgagcctagcattgag tatcaggccaatccctcaggtgaccctgaccaccctggcctgagcattgcgtggggatct tgcgggcatgtcttccacctcgactgcatccagcgatggctcaaaacaaggagtgcatgc ccgctctgcaataaagagtgggagttctcaaagatcgagaaaattctcccgggaggcact gccggcacagactga

DBGET integrated database retrieval system