KEGG   Acinetobacter radioresistens: DOM24_11280
Entry
DOM24_11280       CDS       T05620                                 
Name
(GenBank) 3-oxoacyl-ACP reductase FabG
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
arj  Acinetobacter radioresistens
Pathway
arj00061  Fatty acid biosynthesis
arj00780  Biotin metabolism
arj01100  Metabolic pathways
arj01110  Biosynthesis of secondary metabolites
arj01212  Fatty acid metabolism
arj01240  Biosynthesis of cofactors
Module
arj_M00083  Fatty acid biosynthesis, elongation
arj_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:arj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    DOM24_11280
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    DOM24_11280
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    DOM24_11280
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:arj01004]
    DOM24_11280
Enzymes [BR:arj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     DOM24_11280
Lipid biosynthesis proteins [BR:arj01004]
 Fatty acid synthase
  Component type
   DOM24_11280
SSDB
Motif
Pfam: adh_short_C2 adh_short KR SDR Epimerase DUF1776 NAD_binding_10 HAAS F420_oxidored DUF1490 SecA_SW
Other DBs
NCBI-ProteinID: AWV87141
LinkDB
Position
complement(2409801..2410535)
AA seq 244 aa
MTQERKVALVTGASRGIGAAIAQQLIQDGYFVVGTATSEAGAQKLTQDFAEQGAGAVLDV
RSADAIDTLVTEIEQKYGPVLILVNNAGITKDNLLLRMSEDDWDDILNIHLKAVYRLSKR
VLKGMTRARFGRIINISSVVAHFANPGQANYSAAKAGIEAFSRSLAKEMGSRQITVNCVA
PGFIATEMTEQLSEEIRKKMSDQVALQRLGEPQDIANAVSFLASEKASYITGTVLHVNGG
LYMA
NT seq 735 nt   +upstreamnt  +downstreamnt
atgacacaagaacgtaaggttgctctggttacaggtgcaagccggggcattggtgcggcc
attgctcaacaacttattcaagacggttattttgttgtgggcactgcaacttcggaagca
ggtgcccaaaagctgacccaagactttgcagaacaaggtgctggagcagtgctggatgta
cgtagtgccgacgcaattgatactctggtaactgaaattgagcagaaatatggtccagtt
ctgattctggtcaataatgccggtattactaaagataatttattactgcgtatgtcagaa
gatgactgggatgacatcttaaatattcatttaaaagctgtttatcgtctatctaaacgt
gtattaaaaggcatgacacgtgcccgttttggtcgcatcatcaatatcagttcagtggta
gctcattttgcgaatccggggcaggccaactattctgctgcaaaagctggtattgaggca
tttagccgctcactggcaaaagaaatgggtagccgccagattacagtaaactgtgtggcg
cctggctttatagcaacggaaatgacagagcagttgagcgaagaaatacgtaagaaaatg
agtgatcaagtggcactgcaacgtttaggtgagccacaagatatcgctaatgcagtaagt
ttcttggctagtgaaaaagcaagttacattactggtacagttttacacgtaaatggtggt
ttatacatggcttaa

DBGET integrated database retrieval system