Athalia rosae (coleseed sawfly): 105686743 Help Entry 105686743         CDS       T09776                                  Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism aroa  Athalia rosae (coleseed sawfly) Pathway aroa00510   N-Glycan biosynthesis aroa00513   Various types of N-glycan biosynthesis aroa04141   Protein processing in endoplasmic reticulum Module aroa_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:aroa00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     105686743    00513 Various types of N-glycan biosynthesis     105686743  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     105686743 SSDB OrthologParalogGFIT Motif Pfam:  Ost5 DUF6512 Motif Other DBs NCBI-GeneID:  105686743 NCBI-ProteinID:  XP_012257273 LinkDB All DBs Position 8 Genome browser AA seq 102 aa AA seqDB search MVHAYTSAVLLPVRPRQNISNKMVEIESMTRYISPINPAVFPHLAVVLLGIGIFFTAWFF VYEVTSTKFTRDIFKELLVSLVAAIFSGFGVLFLLLWVGIYV NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atggttcatgcgtatacttcggcagtgcttctaccggttaggccacgtcaaaatatttct aacaaaatggtcgaaatcgagtccatgacgaggtacatctcccccataaatccagcagtg tttccgcacttggctgtggtactcttggggattggaatattttttaccgcatggttcttt gtctacgaagtgaccagtaccaaattcaccagggatatattcaaggagctactcgtctcg ctggtcgctgctatattctcaggattcggagtgctgttcttactactgtgggtcggaatt tatgtttag

DBGET integrated database retrieval system