Athalia rosae (coleseed sawfly): 105690838 Help Entry 105690838         CDS       T09776                                  Name (RefSeq) RING-box protein 1A isoform X1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism aroa  Athalia rosae (coleseed sawfly) Pathway aroa03420   Nucleotide excision repair aroa04120   Ubiquitin mediated proteolysis aroa04141   Protein processing in endoplasmic reticulum aroa04310   Wnt signaling pathway aroa04341   Hedgehog signaling pathway - fly aroa04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:aroa00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     105690838    04120 Ubiquitin mediated proteolysis     105690838   09124 Replication and repair    03420 Nucleotide excision repair     105690838  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     105690838    04341 Hedgehog signaling pathway - fly     105690838    04350 TGF-beta signaling pathway     105690838  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:aroa04121]     105690838    03400 DNA repair and recombination proteins [BR:aroa03400]     105690838 Enzymes [BR:aroa01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      105690838 Ubiquitin system [BR:aroa04121]  Ubiquitin ligases (E3)   UBL E3 ligases    105690838   Multi subunit type E3    SCF complex     Ring finger protein      105690838    Cul2 complex      105690838    Cul3 complex      105690838    Cul4 complex      105690838    Cul7 complex      105690838    Cul8 complex      105690838    Cul9 complex      105690838 DNA repair and recombination proteins [BR:aroa03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       105690838     TCR (transcription coupled repair) factors      Cul4-CSA complex       105690838 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  105690838 NCBI-ProteinID:  XP_012264385 LinkDB All DBs Position 5:4067141..4069066 Genome browser AA seq 113 aa AA seqDB search MASAMDIDDEEIDLPTSSSGKGEKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIE CQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggcatcggctatggatatcgacgatgaagagattgatttgccaacttctagtagtgga aaaggggagaaaaagcgtttcgaagtgaaaaagtggaatgctgtggctttatgggcgtgg gatatcgtcgtcgataattgtgcgatttgtcgaaaccacataatggatctatgcatcgaa tgtcaggcgaatcaagcatctgctactagcgaggaatgtacggtcgcctggggtgtttgt aatcatgcattccatttccattgcatctctcgttggctgaagacgcgtcaagtttgccca ttggacaaccgtgaatgggagttccaaaagtatggccactaa

DBGET integrated database retrieval system