Apteryx rowi (Okarito brown kiwi): 112970486 Help Entry 112970486         CDS       T07573                                  Symbol IFNG Name (RefSeq) interferon gamma   KO K04687   interferon gamma Organism arow  Apteryx rowi (Okarito brown kiwi) Pathway arow03050   Proteasome arow04060   Cytokine-cytokine receptor interaction arow04217   Necroptosis arow04350   TGF-beta signaling pathway arow05164   Influenza A arow05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:arow00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     112970486 (IFNG)  09130 Environmental Information Processing   09132 Signal transduction    04350 TGF-beta signaling pathway     112970486 (IFNG)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     112970486 (IFNG)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     112970486 (IFNG)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     112970486 (IFNG)    05168 Herpes simplex virus 1 infection     112970486 (IFNG)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03051 Proteasome [BR:arow03051]     112970486 (IFNG)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:arow04052]     112970486 (IFNG)    00536 Glycosaminoglycan binding proteins [BR:arow00536]     112970486 (IFNG) Proteasome [BR:arow03051]  Eukaryotic proteasome   Assembling factors    Other assembling factors     112970486 (IFNG) Cytokines and neuropeptides [BR:arow04052]  Cytokines   Interferons    112970486 (IFNG) Glycosaminoglycan binding proteins [BR:arow00536]  Heparan sulfate / Heparin   Cytokines    112970486 (IFNG) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IFN-gamma TelK_muzzle Motif Other DBs NCBI-GeneID:  112970486 NCBI-ProteinID:  XP_025930731 Ensembl:  ENSARWG00000018843 LinkDB All DBs Position Unknown AA seq 165 aa AA seqDB search MTSQTCRLFGLSIIMIYFGRFGSSLILANLQNDIYDLKADFNSSLSDVADGGPIFTEKLK NWTERNEKRIILSQIVSMYLEMLENTDKSKGHVRRISEELFTLKNSLPDGLKKLKDLMDL SKLQMSDLKIQRKAVNELFSVLQTLVETPASFKRKRSQSQRRCKC NT seq 498 nt NT seq  +upstreamnt  +downstreamnt atgacttcccagacttgcagattgtttggtctgtctatcatcatgatttattttggacgt tttggaagtagcttaatacttgctaatctacaaaacgatatatacgacctgaaagcagac tttaactcaagtctttcagatgtagctgatggtggacctatttttacagaaaaactgaaa aactggacagagagaaatgaaaaaaggatcatactgagccagattgtttccatgtacctg gaaatgcttgaaaacaccgacaagtcgaaggggcatgtcagacgcatatctgaggagctc ttcactttgaaaaacagccttcctgatggcttaaagaagctgaaggacctcatggacctg tcaaagcttcagatgagtgatctgaaaatccaacgcaaagctgtgaatgagctgttcagc gtcctacaaacactagtggagaccccagcttctttcaaaagaaaaaggagccagtctcag aggagatgcaaatgttaa

DBGET integrated database retrieval system