KEGG   Arthrobacter sp. PAMC25564: E5206_14865
Entry
E5206_14865       CDS       T06052                                 
Name
(GenBank) 2,3-dihydroxybenzoate-AMP ligase
  KO
K20423  2-hydroxy-7-methoxy-5-methyl-1-naphthoate---CoA ligase [EC:6.2.1.43]
Organism
artp  Arthrobacter sp. PAMC25564
Pathway
artp01059  Biosynthesis of enediyne antibiotics
artp01100  Metabolic pathways
artp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:artp00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01059 Biosynthesis of enediyne antibiotics
    E5206_14865
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:artp01008]
    E5206_14865
Enzymes [BR:artp01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.43  2-hydroxy-7-methoxy-5-methyl-1-naphthoate---CoA ligase
     E5206_14865
Polyketide biosynthesis proteins [BR:artp01008]
 Polyketide tailoring proteins
  Others
   E5206_14865
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-ProteinID: QCB98037
UniProt: A0A4P7SWR2
LinkDB
Position
3182090..3183763
AA seq 557 aa
MTSHTSEGTVPWPADLAAEFRSKGYWEDRPLDAYILETADRLPEKIAIVDGDVRLSYAEL
ANRMDAAAERLLQSGLKADDRIMVQLPNGWQFTVLTLACFRAGIIPVMALPAHRQYELSF
LTELSESRAIAVPDVIKDFDHQALAEGLASTIPSLEYILVSGAAKPANTRLEDILAPGTD
VAGARARLDAAAPSPDSPALFLLSGGTTGLPKLITRTHNDYAYNIKATSIPTGVTEDTVY
LGTLPASHNFPLACPGILGILFAGGRAVMLPSPEPRKAFATIERERVTLSTAVPAVAQRW
IEYQQETGTKQLASLEVLQVGGSRLPDEIARKVKPVLGATLQQVFGMAEGLINTTRLDDP
EEVICTTQGRPVSKADEVRIVDETGEDLPDGVPGSILTRGPYTPRGYYRAPEANSRAFTA
DGWYASGDIVERRPDGNLIVQGRDKDMINRGGEKISAEEIESLVYRIDDVTMAAAVAMPD
QMLGERLCLYITVKPGREVTLEQIQELLRRTGVAAFKIPERLVVVDELPTTKVGKINKKD
LRADIAERLAAASARAQ
NT seq 1674 nt   +upstreamnt  +downstreamnt
atgaccagccacaccagtgaaggcaccgtcccctggcccgcggaccttgcggcagaattc
cgcagcaagggctactgggaagaccgccccctcgacgcctacatcctcgaaacagccgac
cggctgccggaaaaaatcgcgatcgtggacggtgacgtccggctcagctacgccgagttg
gccaacagaatggatgcggccgcggaacgcctcctgcagtcgggcctgaaagcggacgac
cgcatcatggtccagttgcccaacggctggcagttcacggtgctgacccttgcgtgtttc
cgtgccggcatcatcccggtgatggctctgccggcacaccggcaatacgagctatcgttc
ctcacagagctctccgaatcacgggccatcgccgtaccggacgtgatcaaggactttgat
caccaggccctcgccgaaggactggcgtcaaccattccgtccctggagtatatcctcgtt
tcgggagccgcgaaacccgccaacacacgcctcgaagacatccttgcccccggaaccgac
gtggcaggcgcccgtgcccggctggacgccgctgcaccgtcgcctgactcgccagccctc
tttctgctctcgggcggcaccaccgggctgcccaaactgattaccaggacccacaacgac
tacgcctacaacatcaaagccacgtcaattcccaccggagtcaccgaggacactgtttac
ctcggcaccctgccggccagccacaacttcccgctggcctgccccggcatcctcggcatc
ctgttcgccggcggccgggccgtcatgctccccagccccgaaccgcgcaaggcattcgcc
accattgaacgcgaaagagtcaccctgtcaacggccgtccccgcagtggcccagcgatgg
attgagtaccagcaggaaaccggtactaagcagctggccagcctcgaggtgcttcaggtc
ggcggctcgcgccttccggacgagattgcccggaaagtgaagccagtcctgggcgcgacc
ctgcagcaggtcttcggcatggccgaggggctcatcaacaccacccggctggatgatccc
gaggaggtcatctgtactacgcagggccgccccgtatccaaggccgacgaggtccggatc
gtcgatgagaccggcgaggacctgccggacggagtccccggctccatcctgacccgcgga
ccctacacacccaggggctattaccgcgccccggaagccaactcccgggctttcaccgcc
gacggctggtacgccagcggtgacattgtcgagcggcgccccgacggaaacctgatcgtc
cagggccgcgacaaggacatgatcaaccgcggcggagagaaaatctcggccgaggaaatc
gaaagcctggtttaccggatcgatgacgtgaccatggcagccgcggtcgcaatgccggac
cagatgcttggtgaacgcctgtgcctctacatcacggtcaaacccggacgcgaagtgacg
cttgaacaaatccaggagctcctgcgccggaccggtgttgccgccttcaaaatcccggaa
cgcctcgtagtcgtcgacgaactgcccaccaccaaggtcggcaagatcaacaaaaaagac
ctccgcgccgacatcgccgaacgcctggctgccgccagcgcccgcgcacagtaa

DBGET integrated database retrieval system