Alosa sapidissima (American shad): 121706332 Help Entry 121706332         CDS       T11137                                  Symbol rbx1 Name (RefSeq) E3 ubiquitin-protein ligase RBX1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism asad  Alosa sapidissima (American shad) Pathway asad03420   Nucleotide excision repair asad04110   Cell cycle asad04114   Oocyte meiosis asad04120   Ubiquitin mediated proteolysis asad04141   Protein processing in endoplasmic reticulum asad04310   Wnt signaling pathway asad04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:asad00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     121706332 (rbx1)    04120 Ubiquitin mediated proteolysis     121706332 (rbx1)   09124 Replication and repair    03420 Nucleotide excision repair     121706332 (rbx1)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     121706332 (rbx1)    04350 TGF-beta signaling pathway     121706332 (rbx1)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     121706332 (rbx1)    04114 Oocyte meiosis     121706332 (rbx1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:asad04121]     121706332 (rbx1)    03400 DNA repair and recombination proteins [BR:asad03400]     121706332 (rbx1) Enzymes [BR:asad01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      121706332 (rbx1) Ubiquitin system [BR:asad04121]  Ubiquitin ligases (E3)   UBL E3 ligases    121706332 (rbx1)   Multi subunit type E3    SCF complex     Ring finger protein      121706332 (rbx1)    Cul2 complex      121706332 (rbx1)    Cul3 complex      121706332 (rbx1)    Cul4 complex      121706332 (rbx1)    Cul7 complex      121706332 (rbx1)    Cul8 complex      121706332 (rbx1)    Cul9 complex      121706332 (rbx1) DNA repair and recombination proteins [BR:asad03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       121706332 (rbx1)     TCR (transcription coupled repair) factors      Cul4-CSA complex       121706332 (rbx1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  121706332 NCBI-ProteinID:  XP_041943925 LinkDB All DBs Position 3:18082920..18086942 Genome browser AA seq 108 aa AA seqDB search MAAAMDVDTPSGTNSGASKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggcggctgcaatggatgttgatactcccagcggaacaaatagtggagctagcaaaaaa cgttttgaagttaaaaagtggaacgccgttgcactgtgggcctgggacattgtagtagac aactgtgctatttgcaggaatcacatcatggatctctgcattgagtgccaggcaaatcag gcctcagcgacatcagaagagtgcacggtagcgtggggtgtctgcaatcatgctttccat ttccactgcatttctcgttggttgaagaccaggcaggtctgccctcttgataacagagag tgggagttccaaaagtatggacattag

DBGET integrated database retrieval system