Alosa sapidissima (American shad): 121724604 Help Entry 121724604         CDS       T11137                                  Symbol tmem258 Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism asad  Alosa sapidissima (American shad) Pathway asad00510   N-Glycan biosynthesis asad00513   Various types of N-glycan biosynthesis asad04141   Protein processing in endoplasmic reticulum Module asad_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:asad00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     121724604 (tmem258)    00513 Various types of N-glycan biosynthesis     121724604 (tmem258)  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     121724604 (tmem258) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 DUF6512 TctB Motif Other DBs NCBI-GeneID:  121724604 NCBI-ProteinID:  XP_041967218 LinkDB All DBs Position 11:24726312..24729058 Genome browser AA seq 79 aa AA seqDB search MELETMTRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDVYKELLISLVA SLFMGFGVLFLLLWVGIYV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggagctggagactatgacgagatacacgagcccggtgaacccggccgtgttcccccac ctgaccgtggtcctgctggccatcggaatgttcttcacagcctggttctttgtctatgag gtgacgtcgaccaaatacacccgggacgtgtacaaggagctgctgatctcgctggtggcg tcgctcttcatgggtttcggagtgctcttcctgttactgtgggtcggcatctacgtgtga

DBGET integrated database retrieval system