Anolis sagrei ordinatus (Brown anole): 132765949 Help Entry 132765949         CDS       T09595                                  Name (RefSeq) protein max-like   KO K04453   Max protein Organism asao  Anolis sagrei ordinatus (Brown anole) Pathway asao03083   Polycomb repressive complex asao04010   MAPK signaling pathway Brite KEGG Orthology (KO) [BR:asao00001]  09120 Genetic Information Processing   09126 Chromosome    03083 Polycomb repressive complex     132765949  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     132765949  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:asao03000]     132765949    03036 Chromosome and associated proteins [BR:asao03036]     132765949 Transcription factors [BR:asao03000]  Eukaryotic type   Basic helix-loop-helix/leucine zipper (bHLH-ZIP)    Cell cycle controlling factors, Mad/Max     132765949 Chromosome and associated proteins [BR:asao03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.6)      132765949 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  bZIP_2 SlyX DUF7801 PUMA_CC DivIC DUF4763 XhlA Motif Other DBs NCBI-GeneID:  132765949 NCBI-ProteinID:  XP_060616240 LinkDB All DBs Position Unknown AA seq 87 aa AA seqDB search MRRKNHTHQQDIDDLKRQNALLEQQVRALEKARSSAQLQANYSSSDNSLYTNPKGSTISA FDGGSDSSSESELEEPQSRKKLRMEAS NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgcgtcggaaaaaccacacacaccagcaagatattgatgatctaaagcgccagaatgca cttctggagcagcaggttcgtgcactggagaaggcaaggtcaagtgctcagctgcaggcc aactattcctcttcagacaacagcctctacaccaaccccaagggcagcaccatctccgcc tttgatggcggctctgactccagttcagagtctgagctggaagagccccagagccggaag aagcttcgtatggaggccagctag

DBGET integrated database retrieval system