Anolis sagrei ordinatus (Brown anole): 132768186 Help Entry 132768186         CDS       T09595                                  Name (RefSeq) hepatic lectin-like isoform X1   KO K06563   C-type lectin domain family 4 member L/M Organism asao  Anolis sagrei ordinatus (Brown anole) Pathway asao03260   Virion - Human immunodeficiency virus asao03264   Virion - Flavivirus and Alphavirus asao03265   Virion - Ebolavirus, Lyssavirus and Morbillivirus asao03273   Virion - Lassa virus and SFTS virus asao04145   Phagosome asao04625   C-type lectin receptor signaling pathway Brite KEGG Orthology (KO) [BR:asao00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03260 Virion - Human immunodeficiency virus     132768186    03264 Virion - Flavivirus and Alphavirus     132768186    03265 Virion - Ebolavirus, Lyssavirus and Morbillivirus     132768186    03273 Virion - Lassa virus and SFTS virus     132768186  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     132768186  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     132768186  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:asao04131]     132768186   09183 Protein families: signaling and cellular processes    04054 Pattern recognition receptors [BR:asao04054]     132768186    04515 Cell adhesion molecules [BR:asao04515]     132768186    04090 CD molecules [BR:asao04090]     132768186    04091 Lectins [BR:asao04091]     132768186 Membrane trafficking [BR:asao04131]  Endocytosis   Phagocytosis    C-lectin receptors     132768186 Pattern recognition receptors [BR:asao04054]  Membrane-bound pattern recognition receptors   C-type lectin receptors    132768186 Cell adhesion molecules [BR:asao04515]  Lectins   Selectins and C-type lectins    132768186 CD molecules [BR:asao04090]  Proteins   132768186 Lectins [BR:asao04091]  C-Type lectins   Asialoglycoprotein and DC receptors    132768186 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Lectin_C Ubiquitin_6 Motif Other DBs NCBI-GeneID:  132768186 NCBI-ProteinID:  XP_060619832 LinkDB All DBs Position Unknown AA seq 213 aa AA seqDB search MEDEKFQDDFQTNKENNFLQYTQRPNFHVYVMLAVSLLLSTIFMIVALSKGTTLSSDLND LKMKLPKQKPEHDSELFPCGPNSREWEYCNGKCYYFSLQKTSWAQAKHQCEEMRSRLAIV ENMAEQNFLQTRTRNERYWIGLSDIEAENHWKWVDGRDSNNGFTHWAQGEPNDDGKIEDC AHLWNNGEWNDVYCTYPCFYICERPVLGTSPQH NT seq 642 nt NT seq  +upstreamnt  +downstreamnt atggaggatgaaaagtttcaagatgacttccaaactaataaagaaaataattttcttcaa tacacccagaggcctaacttccatgtctatgtgatgttggctgtctctttactactgagc actatcttcatgattgtggctctttccaaaggaacaacgctttcatcagacctgaatgac ctgaaaatgaagctccccaaacaaaagcctgaacatgattctgaattgttcccatgtggt cccaactctagagaatgggagtactgcaatggaaaatgttactacttctccctgcagaaa acttcctgggcgcaggctaagcatcaatgtgaagagatgcgttctcgcttggccatcgtg gagaatatggctgaacagaatttccttcagaccaggaccaggaatgagcgttattggata ggactcagtgacatcgaggctgaaaatcactggaaatgggtggatggcagagacagcaac aatggcttcacgcactgggcacaaggggagcccaatgatgatggtaaaattgaagactgt gcacatctctggaacaacggagaatggaatgatgtctactgcacctatccatgcttctac atctgtgaaaggcctgtgctgggaacaagcccacaacactaa

DBGET integrated database retrieval system