Anolis sagrei ordinatus (Brown anole): 132777528 Help Entry 132777528         CDS       T09595                                  Name (RefSeq) cellular tumor antigen p53-like   KO K04451   tumor protein p53 Organism asao  Anolis sagrei ordinatus (Brown anole) Pathway asao04010   MAPK signaling pathway asao04110   Cell cycle asao04115   p53 signaling pathway asao04137   Mitophagy - animal asao04210   Apoptosis asao04216   Ferroptosis asao04218   Cellular senescence asao04310   Wnt signaling pathway asao05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:asao00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     132777528    04310 Wnt signaling pathway     132777528  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     132777528   09143 Cell growth and death    04110 Cell cycle     132777528    04210 Apoptosis     132777528    04216 Ferroptosis     132777528    04115 p53 signaling pathway     132777528    04218 Cellular senescence     132777528  09160 Human Diseases   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     132777528  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:asao03000]     132777528    03036 Chromosome and associated proteins [BR:asao03036]     132777528    03400 DNA repair and recombination proteins [BR:asao03400]     132777528 Transcription factors [BR:asao03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    p53     132777528 Chromosome and associated proteins [BR:asao03036]  Eukaryotic type   Sister chromatid separation proteins    Aurora kinases     Regulators of Aurora kinases      132777528 DNA repair and recombination proteins [BR:asao03400]  Eukaryotic type   Check point factors    Other check point factors     132777528 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  P53 P53_tetramer DUF8016 CEP1-DNA_bind Motif Other DBs NCBI-GeneID:  132777528 NCBI-ProteinID:  XP_060635848 LinkDB All DBs Position Unknown AA seq 210 aa AA seqDB search CLPAGSAPPQHLIRVEANQLAQYIDDPNTKRHSVVVPYEKAQVGADSTTLLLNFMCNSSC MGGMNRRAILAIITLETLQGDLLGRRCFEVRVCACPGRDRKSEEENAEKATIPKMKSKKV VVPAPPRSSSSESAKRSAAGSSNNESESGPYILQIRDRKHYRMLKVILEALELREEKLQG EEEEAEPEIHRLPKAKRKRLRLKEENPDSD NT seq 633 nt NT seq  +upstreamnt  +downstreamnt tgtctcccggcaggcagcgcgccaccgcagcacctcatcagggtggaggctaatcagctg gcccaatatattgacgacccaaacaccaagcggcacagtgtcgtcgtgccgtatgaaaaa gcacaggtgggtgccgacagcactacgctgttgttaaattttatgtgcaacagctcttgc atgggaggcatgaaccggcgtgccattttggccatcatcactttggagactctgcaaggt gacctcctcggacgccgctgctttgaagtccgggtttgcgcttgtcccggaagagacagg aagtcggaggaagagaacgcggagaaagctaccatccctaaaatgaaatctaagaaggtt gttgttccagctcctcctcggagcagctcttccgaaagcgccaagaggtcggctgcgggg tcttccaacaacgagtccgaaagcggaccctatatcctccagatccgtgatcggaaacac taccggatgctgaaggtaatcctggaagcgcttgaacttcgagaggagaagctgcaagga gaggaggaggaggcggagccagagattcaccgcttgccaaaggcaaaacggaagcggctc cgactaaaggaggagaacccggattcagactaa

DBGET integrated database retrieval system