Anolis sagrei ordinatus (Brown anole): 132779144 Help Entry 132779144         CDS       T09595                                  Symbol IL6 Name (RefSeq) interleukin-6   KO K05405   interleukin 6 Organism asao  Anolis sagrei ordinatus (Brown anole) Pathway asao04060   Cytokine-cytokine receptor interaction asao04068   FoxO signaling pathway asao04218   Cellular senescence asao04620   Toll-like receptor signaling pathway asao04621   NOD-like receptor signaling pathway asao04623   Cytosolic DNA-sensing pathway asao04625   C-type lectin receptor signaling pathway asao04672   Intestinal immune network for IgA production asao05132   Salmonella infection asao05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:asao00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     132779144 (IL6)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     132779144 (IL6)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     132779144 (IL6)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     132779144 (IL6)    04621 NOD-like receptor signaling pathway     132779144 (IL6)    04623 Cytosolic DNA-sensing pathway     132779144 (IL6)    04625 C-type lectin receptor signaling pathway     132779144 (IL6)    04672 Intestinal immune network for IgA production     132779144 (IL6)  09160 Human Diseases   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     132779144 (IL6)   09171 Infectious disease: bacterial    05132 Salmonella infection     132779144 (IL6)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:asao04052]     132779144 (IL6) Cytokines and neuropeptides [BR:asao04052]  Cytokines   Interleukins    132779144 (IL6) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL6 GCSF IL23 IL11 SAM_decarbox Motif Other DBs NCBI-GeneID:  132779144 NCBI-ProteinID:  XP_060638833 LinkDB All DBs Position Unknown AA seq 207 aa AA seqDB search MRALLSACFCFWASAALLLRVDSFPVGDSSGEDELGDEPQGYSPRRACTGLVWGLHSTAS GWKDQLCKEQNACRGSMEMLVQNNLHLPKITPEDGCSYTGFQKETCLRRLSSGLYAYQAY LEYIDDTFSKSIQRSGSLWTRTQQLADILKSMMNNPDVVTMPPPITQDMISVKLREQKAW NVTVIKFLILQDFISLLEKTERAFCHL NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgcgcgctctgctctccgcatgcttctgcttctgggcgagcgctgcccttctgctccgt gtggactcgttccccgtgggcgattcttctggggaggacgaattaggagacgagccccag ggatattcaccgcggcgcgcttgcactggtttggtttggggactccactccacagcctcc gggtggaaagaccagctctgtaaggagcaaaatgcatgtagaggtagcatggaaatgctg gtccaaaataatctccaccttccgaagatcactccagaagatggatgttcttacacagga ttccaaaaggagacatgtttgagaagactttcaagtggcctttatgcttatcaagcatac ctggaatacatagatgatacttttagcaagtctatacagaggagtggatctctgtggacc agaacacagcaactagcggatatcttgaaatcaatgatgaacaatcctgatgttgtaact atgccgcctcctattactcaagatatgatttcagtaaaactacgtgaacaaaaagcttgg aatgtaacagttatcaagttccttatacttcaagattttatctcattactggagaaaact gaaagagctttttgccatttatga

DBGET integrated database retrieval system