Actinoplanes sp. SE50/110: ACPL_7079 Help Entry ACPL_7079         CDS       T02044                                  Symbol folA Name (GenBank) dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism ase  Actinoplanes sp. SE50/110 Pathway ase00670   One carbon pool by folate ase00790   Folate biosynthesis ase01100   Metabolic pathways ase01240   Biosynthesis of cofactors ase04981   Folate transport and metabolism Module ase_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:ase00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     ACPL_7079 (folA)    00670 One carbon pool by folate     ACPL_7079 (folA)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     ACPL_7079 (folA) Enzymes [BR:ase01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      ACPL_7079 (folA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-ProteinID:  AEV87959 UniProt:  G8SFG8 LinkDB All DBs Position complement(7818662..7819129) Genome browser AA seq 155 aa AA seqDB search MSVHLIWAQAHRRVIGAGGDIPWHVPGEQAIFKERTAGSTVVMGRATWDSLPRRPLPGRR NVVLTRDPGWTGDGAHVVHSPDLIGEVDFWVIGGAAVYQLFLPVAEHIVRTSIELDVEGD TFAPELGPDWKVTASTGWLTAPNGIRYVVEDLARV NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atgagcgtgcacctgatctgggcgcaggcgcaccgccgggtgatcggggcgggcggggac atcccctggcacgtgcccggcgagcaggcgatcttcaaggagcggaccgccgggtcgacc gtggtgatgggacgcgccacctgggactcgctgccccggcggccactgccggggcggcgc aacgtggtgctcacccgcgatcccgggtggaccggggacggggcccacgtcgtacacagt ccggatctgattggcgaagttgacttctgggtgatcggcggggccgctgtctaccagctg tttctgccggtcgccgagcacattgtgcggacgtcgatcgagctggacgtggagggcgac accttcgcgccggagctgggcccggactggaaggtgaccgcctccacggggtggctgacc gcgccgaacgggatccgctacgtggtggaggacctagctcgggtctag

DBGET integrated database retrieval system