Alligator sinensis (Chinese alligator): 102377828 Help Entry 102377828         CDS       T02922                                  Symbol IL6 Name (RefSeq) interleukin-6   KO K05405   interleukin 6 Organism asn  Alligator sinensis (Chinese alligator) Pathway asn04060   Cytokine-cytokine receptor interaction asn04068   FoxO signaling pathway asn04218   Cellular senescence asn04620   Toll-like receptor signaling pathway asn04621   NOD-like receptor signaling pathway asn04623   Cytosolic DNA-sensing pathway asn04625   C-type lectin receptor signaling pathway asn04672   Intestinal immune network for IgA production asn05132   Salmonella infection asn05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:asn00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     102377828 (IL6)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102377828 (IL6)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     102377828 (IL6)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102377828 (IL6)    04621 NOD-like receptor signaling pathway     102377828 (IL6)    04623 Cytosolic DNA-sensing pathway     102377828 (IL6)    04625 C-type lectin receptor signaling pathway     102377828 (IL6)    04672 Intestinal immune network for IgA production     102377828 (IL6)  09160 Human Diseases   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     102377828 (IL6)   09171 Infectious disease: bacterial    05132 Salmonella infection     102377828 (IL6)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:asn04052]     102377828 (IL6) Cytokines and neuropeptides [BR:asn04052]  Cytokines   Interleukins    102377828 (IL6) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL6 GCSF IL11 IL23 Motif Other DBs NCBI-GeneID:  102377828 NCBI-ProteinID:  XP_025065804 UniProt:  A0A3Q0H1B8 LinkDB All DBs Position Unknown AA seq 152 aa AA seqDB search MCEKFTVCENSMEMLVQSHLKLPKILDEDSCLQSGFNKEKCLTKISSGLFAFQPYLEYIH VQETFISEKQKIETIWYGTKHLANTVRQMMENPDAVPIPDQTSQKTLLEKLKANKNWREK IATHFILRDFTSFMEKTVRALRYIRKTRSSSA NT seq 459 nt NT seq  +upstreamnt  +downstreamnt atgtgtgagaaatttactgtgtgtgaaaacagcatggaaatgcttgtccaaagccatctg aaactccccaagatcctggatgaagacagctgcttacagtctggattcaacaaggagaaa tgcttgacaaagatctccagtggcctttttgcatttcaaccatatctggaatatatacat gtacaagaaacatttattagtgaaaagcaaaaaattgaaaccatatggtatggcacaaag cacctggcaaacactgtgaggcagatgatggaaaatcctgatgcggtgcccataccagac caaactagtcagaaaacgcttcttgaaaaactaaaggcaaataagaactggagagagaaa attgccactcatttcatcctcagagattttacttcatttatggagaaaacagtgagggct cttcgatacataagaaaaaccaggagttcaagtgcttga

DBGET integrated database retrieval system