Alteromonas stellipolaris LMG 21856: AOR13_2809 Help Entry AOR13_2809        CDS       T04153                                  Name (GenBank) Dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism asp  Alteromonas stellipolaris LMG 21856 Pathway asp00790   Folate biosynthesis asp01100   Metabolic pathways asp01240   Biosynthesis of cofactors Module asp_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:asp00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     AOR13_2809 Enzymes [BR:asp01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      AOR13_2809  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      AOR13_2809  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      AOR13_2809 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  ALM91813 LinkDB All DBs Position complement(3245505..3245870) Genome browser AA seq 121 aa AA seqDB search MKRFMGKIYITGLAVDTLIGVYDWERERLTTLLLDVELDADLNAAMLSDNVDDTINYADV ADCITEVGKNSRFMLLEAFGGAVMKQVLATFPAHAIRLKIVKPNILPNAQTVAVAMYQDK S NT seq 366 nt NT seq  +upstreamnt  +downstreamnt atgaaaaggtttatgggaaaaatatatataacagggctagctgtcgataccctcatcggt gtgtacgattgggaacgggagcgtttaaccacgttgttgctcgatgttgaactcgacgct gacctaaatgctgcaatgctgtcggataatgttgatgacaccattaactatgccgacgtg gctgattgcattactgaggttggaaaaaacagtcgctttatgctgctagaggcatttggt ggcgctgtaatgaagcaagtacttgccacctttccggcccatgctattcgcttgaaaatt gtgaagccgaatattcttcctaatgcacaaacggtggcagtggctatgtatcaggataag tcctag

DBGET integrated database retrieval system