Acetobacter oryzifermentans: WG31_08340 Help Entry WG31_08340        CDS       T04478                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism asv  Acetobacter oryzifermentans Pathway asv01100   Metabolic pathways asv01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:asv00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     WG31_08340    00074 Mycolic acid biosynthesis     WG31_08340   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     WG31_08340 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  ANA14009 LinkDB All DBs Position 1770549..1770800 Genome browser AA seq 83 aa AA seqDB search MSETVESVSALIIQKLLANPKVPRDIDGNCKIMEDLAFDSLAVMNFVMEVEDSLDVSIPL DKLADIRTINDLAACIVALKNKG NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgagcgaaaccgttgaaagcgtttccgcgctgatcattcaaaagctcctcgccaacccg aaggttccgcgtgacattgatggtaactgcaagatcatggaagatcttgcgtttgattct ttggccgtcatgaacttcgttatggaagttgaagatagcttggatgtttccatcccgctc gacaaacttgccgatatccggacgattaatgaccttgccgcatgcattgtcgctctgaaa aacaaagggtga

DBGET integrated database retrieval system