KEGG   Atopobium sp. oral taxon 416: J4859_01010
Entry
J4859_01010       CDS       T07170                                 
Symbol
fabG
Name
(GenBank) 3-oxoacyl-[acyl-carrier-protein] reductase
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
atb  Atopobium sp. oral taxon 416
Pathway
atb00061  Fatty acid biosynthesis
atb00780  Biotin metabolism
atb01100  Metabolic pathways
atb01110  Biosynthesis of secondary metabolites
atb01212  Fatty acid metabolism
atb01240  Biosynthesis of cofactors
Module
atb_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:atb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    J4859_01010 (fabG)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    J4859_01010 (fabG)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    J4859_01010 (fabG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:atb01004]
    J4859_01010 (fabG)
Enzymes [BR:atb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     J4859_01010 (fabG)
Lipid biosynthesis proteins [BR:atb01004]
 Fatty acid synthase
  Component type
   J4859_01010 (fabG)
SSDB
Motif
Pfam: adh_short_C2 adh_short KR Epimerase SDR MutL GDP_Man_Dehyd
Other DBs
NCBI-ProteinID: QUC03575
LinkDB
Position
206951..207724
AA seq 257 aa
MADQATGTLERDASRRVALVTGGSRGIGRACARSLAREGFDIAIIYAGNREAAADCVQEL
SKLGATAKAYQCDVANSAQVNDTVKAIIADFGPVWALVNDAGINRDGLLARMKDEDFDAV
IDVNLKGAFNMIRALSRNFVRLRGGRIISISSVVGLSGNAGQANYAASKAGLIGLTKAVA
KELGHRGVTVNTVAPGFIKTDMTDKLPEKTVKAYQAQIPMNRLGSVDEVGDVVAFLVSDA
ASYITGEVIRVDGGLSM
NT seq 774 nt   +upstreamnt  +downstreamnt
gtggcagatcaggcaacagggacccttgagcgggacgcctcaagacgtgttgcgctcgtg
accggtggctcccgcggtatcggcagagcctgtgcgcgctcacttgcccgtgagggtttt
gatatcgcaatcatctatgccggcaatagagaagctgcggcagactgtgtgcaggaactt
agcaagctcggcgctaccgcgaaggcctatcagtgtgatgtcgcgaattccgctcaggtc
aacgacaccgtcaaagcaatcatcgcagatttcggtccggtctgggccctcgttaacgat
gcaggtatcaaccgtgatggcctcttggcacgcatgaaggacgaggactttgacgcggtt
atcgacgtgaacctcaaaggtgccttcaatatgatccgagcgctgagtaggaactttgtc
cgcctgcgcggtggccgcatcatctcgatcagctccgtagtcggactctccggcaatgcc
ggccaggctaattatgccgcttcaaaagccggtttgatcggcttgaccaaagcggtggcc
aaagagttgggccaccgcggtgtgacggtcaatacggtcgctccgggcttcattaagacg
gatatgacggacaagctgcccgagaagaccgtcaaagcgtaccaggctcagattcccatg
aatagactgggaagcgtcgacgaggtgggagacgttgtggcgttcctcgtatcggatgcc
gccagctatatcaccggcgaagtcatccgcgtagacggtggactgagcatgtag

DBGET integrated database retrieval system