KEGG   Arabidopsis thaliana (thale cress): AT1G09530
Entry
AT1G09530         CDS       T00041                                 

Symbol
PIF3
Name
(RefSeq) phytochrome interacting factor 3
  KO
K12126  phytochrome-interacting factor 3
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04075  Plant hormone signal transduction
ath04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:ath00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04075 Plant hormone signal transduction
    AT1G09530 (PIF3)
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    AT1G09530 (PIF3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ath03000]
    AT1G09530 (PIF3)
Transcription factors [BR:ath03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   HLH domain only
    AT1G09530 (PIF3)
SSDB
Motif
Pfam: HLH
Other DBs
NCBI-GeneID: 837479
NCBI-ProteinID: NP_001322701
TAIR: AT1G09530
UniProt: O80536 A0A5S9TG51
LinkDB
Position
1:3075768..3079654
AA seq 524 aa
MPLFELFRLTKAKLESAQDRNPSPPVDEVVELVWENGQISTQSQSSRSRNIPPPQANSSR
AREIGNGSKTTMVDEIPMSVPSLMTGLSQDDDFVPWLNHHPSLDGYCSDFLRDVSSPVTV
NEQESDMAVNQTAFPLFQRRKDGNESAPAASSSQYNGFQSHSLYGSDRARDLPSQQTNPD
RFTQTQEPLITSNKPSLVNFSHFLRPATFAKTTNNNLHDTKEKSPQSPPNVFQTRVLGAK
DSEDKVLNESVASATPKDNQKACLISEDSCRKDQESEKAVVCSSVGSGNSLDGPSESPSL
SLKRKHSNIQDIDCHSEDVEEESGDGRKEAGPSRTGLGSKRSRSAEVHNLSERRRRDRIN
EKMRALQELIPNCNKVDKASMLDEAIEYLKSLQLQVQIMSMASGYYLPPAVMFPPGMGHY
PAAAAAMAMGMGMPYAMGLPDLSRGGSSVNHGPQFQVSGMQQQPVAMGIPRVSGGGIFAG
SSTIGNGSTRDLSGSKDQTTTNNNSNLKPIKRKQGSSDQFCGSS
NT seq 1575 nt   +upstreamnt  +downstreamnt
atgcctctgtttgagcttttcaggctcaccaaagctaagcttgaatctgctcaagacagg
aacccttctccacctgtagatgaagttgtggagctggtgtgggaaaatggtcagatatca
actcaaagtcagtcaagtagatcgaggaacattcctccaccacaagcaaactcttctaga
gctagagagattggaaatggctcaaagacgactatggtggacgagatccctatgtcagtg
ccatcactaatgacgggtttgagtcaagacgatgactttgttccatggttgaatcatcat
ccctcccttgatggatattgctctgatttcttgcgtgatgtgtcgtctcctgttactgtc
aacgagcaagagagtgatatggcggtaaaccaaactgctttcccgttgtttcagagaaga
aaggatggcaatgaatcagctcctgctgcttcttcgtcgcagtataacggtttccaatcg
cattctctgtatggaagtgatagagctagagatcttcctagccaacaaaccaatccggat
cggtttactcagacgcaggaaccactaattactagtaacaagcctagtttggtcaacttt
tcacatttcttacgccctgcaacttttgcgaagactactaataataaccttcatgacact
aaagaaaagagtcctcaaagcccgccaaatgtgtttcagaccagagttcttggagctaaa
gactctgaagataaggttcttaacgagtctgttgcttctgctacgcctaaagataaccaa
aaggcttgcctaatatcagaggactcatgtagaaaagaccaagagagtgaaaaagcagtt
gtatgttcttctgttggctcgggtaatagtctcgatggcccatccgaaagtccttcactt
tctttaaagagaaagcattcgaatattcaagacattgactgtcatagtgaagatgtggaa
gaagaatcaggagatggaagaaaggaagcaggtccatctcgaacgggtttgggttcaaag
agaagccgctctgcagaagtgcataatctgtctgaaaggagacggcgtgataggatcaac
gagaagatgcgtgccctgcaagaactcattccaaactgtaacaaggtggacaaagcttcg
atgctagatgaagccatcgagtatctcaagtcactccaacttcaagtgcagatcatgtca
atggcgtctggttactatctgccaccggcggttatgttcccaccgggtatggggcattac
ccggcagcagctgctgcaatggcaatgggtatgggaatgccttatgcaatgggcttgcct
gatttgagccgtggtggttcatcggttaaccacggaccacagttccaagtctcggggatg
caacaacaaccagtggcgatgggtattccacgtgtctctggtggtggtatctttgccggt
tcttcgacgattggcaatggctcgactagagatttatctggttctaaagatcaaacaacg
acgaataacaacagtaacttgaaaccaataaagagaaaacaggggtcttctgatcagttt
tgtggatcgtcgtga

DBGET integrated database retrieval system