Arabidopsis thaliana (thale cress): AT3G42830 Help Entry AT3G42830         CDS       T00041                                  Name (RefSeq) RING/U-box superfamily protein   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism ath  Arabidopsis thaliana (thale cress) Pathway ath03420   Nucleotide excision repair ath04120   Ubiquitin mediated proteolysis ath04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:ath00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     AT3G42830    04120 Ubiquitin mediated proteolysis     AT3G42830   09124 Replication and repair    03420 Nucleotide excision repair     AT3G42830  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:ath04121]     AT3G42830    03400 DNA repair and recombination proteins [BR:ath03400]     AT3G42830 Enzymes [BR:ath01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      AT3G42830 Ubiquitin system [BR:ath04121]  Ubiquitin ligases (E3)   UBL E3 ligases    AT3G42830   Multi subunit Ring-finger type E3    SCF complex     Ring finger protein      AT3G42830    Cul2 complex      AT3G42830    Cul3 complex      AT3G42830    Cul4 complex      AT3G42830    Cul7 complex      AT3G42830    Cul8 complex      AT3G42830    Cul9 complex      AT3G42830 DNA repair and recombination proteins [BR:ath03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       AT3G42830     TCR (transcription coupled repair) factors      Cul4-CSA complex       AT3G42830 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-Nse zf-RING_16 Motif Other DBs NCBI-GeneID:  823327 NCBI-ProteinID:  NP_189869 TAIR:  AT3G42830 UniProt:  Q9M2B0 A0A5S9XIZ6 LinkDB All DBs Position 3:complement(14929714..14930678) Genome browser AA seq 115 aa AA seqDB search MASLNSDVIMGESSSISVPSSSSKNSKRFELKKWSAVALWAWDIVVDNCAICRNHIMDLC IECLANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDVCEWEFQKYGH NT seq 348 nt NT seq  +upstreamnt  +downstreamnt atggcttctctcaactccgacgttatcatgggtgaatcctcctccatctccgtaccttca tcttcgtccaagaactcgaaacgatttgaattaaagaagtggagtgctgtcgctctctgg gcttgggatatcgttgttgataactgcgcaatttgtaggaatcacatcatggatctctgt attgaatgtctagctaatcaagctagtgccactagtgaggaatgcactgttgcttggggg gtttgcaaccacgcctttcacttccactgtatcagcagatggctcaaaactcgtcaagtg tgtccactagatgtctgcgagtgggaattccagaaatatggtcactaa

DBGET integrated database retrieval system