Amborella trichopoda: 18439492 Help Entry 18439492          CDS       T02990                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism atr  Amborella trichopoda Pathway atr03420   Nucleotide excision repair atr04120   Ubiquitin mediated proteolysis atr04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:atr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     18439492    04120 Ubiquitin mediated proteolysis     18439492   09124 Replication and repair    03420 Nucleotide excision repair     18439492  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:atr04121]     18439492    03400 DNA repair and recombination proteins [BR:atr03400]     18439492 Enzymes [BR:atr01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      18439492 Ubiquitin system [BR:atr04121]  Ubiquitin ligases (E3)   UBL E3 ligases    18439492   Multi subunit type E3    SCF complex     Ring finger protein      18439492    Cul2 complex      18439492    Cul3 complex      18439492    Cul4 complex      18439492    Cul7 complex      18439492    Cul8 complex      18439492    Cul9 complex      18439492 DNA repair and recombination proteins [BR:atr03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       18439492     TCR (transcription coupled repair) factors      Cul4-CSA complex       18439492 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  18439492 NCBI-ProteinID:  XP_006849719 UniProt:  W1PVI7 LinkDB All DBs Position Unknown AA seq 123 aa AA seqDB search MATMDTDINMVPAGEGSSGAGPSNTTATSSSKKPKRFEIKKWNAVALWAWDIVVDNCAIC RNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQK YGH NT seq 372 nt NT seq  +upstreamnt  +downstreamnt atggctaccatggacacagatattaacatggtccctgcgggtgaaggctcaagcggagct ggacccagcaacaccacagccacctcttcctccaagaaacctaagcgtttcgagattaag aaatggaacgccgtcgccctatgggcttgggatattgtagtcgataattgcgcaatatgc aggaaccatatcatggatctatgcatagagtgccaagctaatcaagctagtgcgaccagt gaagaatgcacagttgcatggggtgtttgtaaccacgctttccacttccactgcatcagt cggtggctaaagacgcgtcaagtctgccctctagataacagtgagtgggaattccagaag tatgggcattaa

DBGET integrated database retrieval system