Amaranthus tricolor (tampala): 130813766 Help Entry 130813766         CDS       T09367                                  Name (RefSeq) RING-box protein 1a-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism atri  Amaranthus tricolor (tampala) Pathway atri03420   Nucleotide excision repair atri04120   Ubiquitin mediated proteolysis atri04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:atri00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     130813766    04120 Ubiquitin mediated proteolysis     130813766   09124 Replication and repair    03420 Nucleotide excision repair     130813766  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:atri04121]     130813766    03400 DNA repair and recombination proteins [BR:atri03400]     130813766 Enzymes [BR:atri01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      130813766 Ubiquitin system [BR:atri04121]  Ubiquitin ligases (E3)   UBL E3 ligases    130813766   Multi subunit type E3    SCF complex     Ring finger protein      130813766    Cul2 complex      130813766    Cul3 complex      130813766    Cul4 complex      130813766    Cul7 complex      130813766    Cul8 complex      130813766    Cul9 complex      130813766 DNA repair and recombination proteins [BR:atri03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       130813766     TCR (transcription coupled repair) factors      Cul4-CSA complex       130813766 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  130813766 NCBI-ProteinID:  XP_057535612 LinkDB All DBs Position 5:complement(22381690..22386420) Genome browser AA seq 113 aa AA seqDB search MDTDVVMVPAGEGSSIGGPSSKKPKRFEIKKWNAVALWAWDIVVDNCAICRNHIMDLCIE CQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggatacagacgtagtaatggtacctgccggcgagggttccagcatcggaggtccttct tccaagaaacctaaacgtttcgagatcaaaaagtggaacgctgttgctctttgggcttgg gatattgtcgttgataattgtgcgatttgccgcaatcatattatggatctatgtattgaa tgccaagctaatcaagctagtgctacgagcgaggagtgcactgttgcgtggggtgtctgc aatcatgccttccatttccattgcatcagccgttggttgaaaactcgacaagtctgtcca ttagataacagcgagtgggagtttcagaaatatggtcattag

DBGET integrated database retrieval system