Aegilops tauschii (wheat D): 109739958 Help Entry 109739958         CDS       T04345                                  Name (RefSeq) uncharacterized protein   KO K26502   transmembrane protein 258 Organism ats  Aegilops tauschii (wheat D) Pathway ats00510   N-Glycan biosynthesis ats00513   Various types of N-glycan biosynthesis ats04141   Protein processing in endoplasmic reticulum Module ats_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:ats00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     109739958    00513 Various types of N-glycan biosynthesis     109739958  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     109739958 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 DUF6338 Motif Other DBs NCBI-GeneID:  109739958 NCBI-ProteinID:  XP_020170151 UniProt:  A0A453SCW1 LinkDB All DBs Position 7:complement(471143553..471145908) Genome browser AA seq 76 aa AA seqDB search MAAKAISSPVPVEWYPTLAVVMVSVGLMLTASFFIYEATTSRRNRSLTKEIVTASIASVF LGFGSLFVLLASGVYV NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggcggccaaggcgatctccagccccgtgccggtggaatggtacccgacgctggccgtc gtcatggtctccgtcggcctcatgctcaccgcatccttcttcatttatgaagccacgact tcaaggcggaaccgtagtttaaccaaggagattgtcacagcgtccattgcttctgtcttc ctgggctttggttctctgttcgtgctccttgcaagcggtgtttatgtctga

DBGET integrated database retrieval system