Agrobacterium fabrum: Atu2082
Help
Entry
Atu2082 CDS
T00070
Name
(GenBank) DNA ligase
KO
K01972
DNA ligase (NAD+) [EC:
6.5.1.2
]
Organism
atu
Agrobacterium fabrum
Pathway
atu03030
DNA replication
atu03410
Base excision repair
atu03420
Nucleotide excision repair
atu03430
Mismatch repair
Brite
KEGG Orthology (KO) [BR:
atu00001
]
09120 Genetic Information Processing
09124 Replication and repair
03030 DNA replication
Atu2082
03410 Base excision repair
Atu2082
03420 Nucleotide excision repair
Atu2082
03430 Mismatch repair
Atu2082
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03032 DNA replication proteins [BR:
atu03032
]
Atu2082
03400 DNA repair and recombination proteins [BR:
atu03400
]
Atu2082
Enzymes [BR:
atu01000
]
6. Ligases
6.5 Forming phosphoric-ester bonds
6.5.1 Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
6.5.1.2 DNA ligase (NAD+)
Atu2082
DNA replication proteins [BR:
atu03032
]
Prokaryotic type
DNA Replication Elongation Factors
Elongation factors (bacterial)
Other elongation factors
Atu2082
DNA repair and recombination proteins [BR:
atu03400
]
Prokaryotic type
SSBR (single strand breaks repair)
BER (base exicision repair)
DNA ligase
Atu2082
NER (nucleotide excision repair)
GGR (global genome repair) factors
Atu2082
MMR (mismatch excision repair)
DNA ligase
Atu2082
DSBR (double strand breaks repair)
NHEJ (non-homologous end-joining)
SHDIR (short-homology-dependent illegitimate recombination)
RecET pathway
Atu2082
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
DNA_ligase_aden
DNA_ligase_OB
HHH_2
BRCT
DNA_ligase_ZBD
HHH_5
PTCB-BRCT
HHH
Nlig-Ia
RNA_ligase
Lar_restr_allev
RUBY_RBDX
DZR_2
Motif
Other DBs
NCBI-ProteinID:
AAK87832
UniProt:
A9CIB3
LinkDB
All DBs
Position
circular:complement(2040803..2042977)
Genome browser
AA seq
724 aa
AA seq
DB search
MSKDQIPVENLTELEASSELAFLAAELARHDALYHGKDAPEISDADYDALKRRNDAIEAA
FPALVRADSPSKKVGFTPLPTFAPIVHARPMLSLDNTFSEEDLRDFVSSVYRFLGHLPDD
SIAFTAEPKIDGLSMSIRYENRKLKTAATRGDGTTGENVTANIRTIKEIPNELPADAPDV
VEVRGEVYMAKSDFLALNAQMEADGKQTYVNPRNTASGSLRQLDANVTAKRKLRFFAYAL
GEVSNGGQPARIADTQYGIVEKFREWGFPVNPLMKRFTSAQQLLEHYNEIGVARPDLDYD
IDGVVYKVDRLDLQERLGFRSRSPRWATAHKFPAEQAFTTVENIEIQVGRTGALTPVARL
TPITVGGVVVTNATLHNADYIEGIGNSGERIRPEDHDIRIGDTVIVQRAGDVIPQVLDVL
LEKRAAGAAKYVFPEKCPVCGSHAVRERNEKTGKLDSVTRCTGGFVCRAQAVEHLKHFVS
RNAFDIEGLGTKQIDFFFESDDPALSIKTAPDIFTLKARQEASHLTKLENIDGFGKVSVK
KLFDAIDARRAIDLHRLIFALGIRHVGETTAKLLARSYGTYEHFEKAMKAAADPASDAWA
ELNSIDGIGEVVARAIIEFYKEPRNLDVIDRLIRELQPKEAEKPSTEGSPVAGKTVVFTG
SLEKFTRDEAKARAESLGAKVAGSVSKKTDILVAGPGAGSKLAKATELGVQTMDEDEWLA
LIGG
NT seq
2175 nt
NT seq
+upstream
nt +downstream
nt
atgtcgaaagaccagattcccgtcgaaaacctgaccgagcttgaagcctcttcggagctg
gcgtttctggcagccgagcttgcccgtcatgatgcgctttaccacggcaaggacgcaccg
gagatttccgatgccgactatgatgcgctgaagcggcgcaacgatgccatcgaagcggcg
tttccggcattggtgcgggctgacagcccgtcgaagaaagtcggcttcacaccgttgccg
accttcgcgcccatcgtgcatgcccgtccgatgctgtcgctcgacaatacgttttcggaa
gaggacctgcgcgatttcgtcagttccgtctatcgtttcctcgggcacttgcctgatgat
tccatcgcctttaccgccgagccgaagatcgacgggctttccatgtcgatccgctatgag
aaccgcaagctcaaaacggcggcgacgcgcggcgatggtacgaccggcgaaaacgtcacc
gccaatatcaggaccatcaaggaaattccgaacgaactgccggccgatgcgcccgatgtg
gtggaggtacgcggcgaagtctatatggccaagagcgacttcctggcgctgaacgcccag
atggaggccgatggcaagcagacctatgtgaacccgcgcaacacggcatccggttctctg
cgccagctcgatgcgaatgtgacggcgaaacgcaagctgcggttctttgcctacgcgctg
ggtgaagtctccaacggcggccagccggcgcggattgccgatacgcaatatggcatcgtc
gagaagttccgggagtggggattcccggtcaatccgctgatgaagcgattcacctccgcc
cagcaattgcttgagcattataatgaaatcggtgtcgcacggcccgatctcgattacgat
attgacggcgtcgtctataaggtcgaccggctcgatcttcaggaacgtctgggtttccgc
tcccgcagcccgcgctgggccactgcacacaagtttccggccgagcaggcctttaccacc
gtcgagaatatcgaaattcaggtgggacgcaccggcgctttgacgccggtggcgcgcctc
acgccgatcaccgttggcggcgtggtcgtcaccaatgcgacgttgcacaatgccgattat
atcgaaggcatcggcaatagcggcgagcgtatccgcccggaggatcatgacattcgcatc
ggcgacactgtcatcgtgcagcgtgccggcgatgtcattccgcaggtgctggatgtgctt
ctggagaagcgcgcggctggggcggcgaaatatgtttttccggagaaatgtccggtctgc
ggcagccatgcggtgcgggaacgcaacgaaaagaccggcaagctcgattcggtcacccgc
tgcaccggcggtttcgtctgccgggcgcaggcggtggagcatctgaaacatttcgtctcg
cgtaatgccttcgacattgaagggctgggcaccaagcagatcgatttcttcttcgaaagc
gacgatccggcactttcgatcaagaccgcgcctgacatttttacgctgaaggcgcggcag
gaagcgtctcatctgaccaagctcgagaatatcgacggcttcggcaaggttagcgtgaag
aagctgttcgatgcgatcgatgcccgccgtgcgattgatctacaccggctgattttcgcg
ctcggcatccgtcacgtcggcgagaccacggcgaagcttctggcgcgttcctatggcact
tatgagcatttcgagaaggcgatgaaggcggcggccgatccggcgagcgatgcctgggcg
gaactcaacagtatcgacggcatcggcgaggtggtggcccgtgccatcatcgagttttac
aaggagccgcgcaatctcgatgttatcgaccggctgatacgggagcttcagccgaaggag
gccgagaagccttcaactgagggcagcccggtggcaggcaagactgtcgtctttaccggc
tcgctggaaaaattcacccgcgatgaggcgaaggcgcgggccgaaagcctgggcgcaaag
gttgccggttccgtttcgaaaaagacggatattctggtggcagggccgggggcgggctcc
aagcttgccaaggcgacggagctgggtgtgcagaccatggacgaggatgagtggctggcg
ttgatcggcggctga
DBGET
integrated database retrieval system