Achromobacter xylosoxidans A8: AXYL_00630 Help Entry AXYL_00630        CDS       T01341                                  Symbol acpP1 Name (GenBank) acyl carrier protein 1   KO K14188   D-alanine--poly(phosphoribitol) ligase subunit 2 [EC:6.1.1.13] Organism axy  Achromobacter xylosoxidans A8 Pathway axy00470   D-Amino acid metabolism axy00552   Teichoic acid biosynthesis axy01100   Metabolic pathways axy01503   Cationic antimicrobial peptide (CAMP) resistance axy02020   Two-component system Brite KEGG Orthology (KO) [BR:axy00001]  09100 Metabolism   09106 Metabolism of other amino acids    00470 D-Amino acid metabolism     AXYL_00630 (acpP1)   09107 Glycan biosynthesis and metabolism    00552 Teichoic acid biosynthesis     AXYL_00630 (acpP1)  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     AXYL_00630 (acpP1)  09160 Human Diseases   09175 Drug resistance: antimicrobial    01503 Cationic antimicrobial peptide (CAMP) resistance     AXYL_00630 (acpP1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    01504 Antimicrobial resistance genes [BR:axy01504]     AXYL_00630 (acpP1) Enzymes [BR:axy01000]  6. Ligases   6.1  Forming carbon-oxygen bonds    6.1.1  Ligases forming aminoacyl-tRNA and related compounds     6.1.1.13  D-alanine---poly(phosphoribitol) ligase      AXYL_00630 (acpP1) Antimicrobial resistance genes [BR:axy01504]  Gene sets   CAMP resistance modules    Cationic antimicrobial peptide (CAMP) resistance, dltABCD operon [MD:M00725]     AXYL_00630 (acpP1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding GD_AH_second DUF7080 Motif Other DBs NCBI-ProteinID:  ADP13988 UniProt:  E3HE78 LinkDB All DBs Position 673674..673913 Genome browser AA seq 79 aa AA seqDB search MHTEQELHTKIGEIVESIVMKKVTPDTQLIATGLVDSLAAVDITLAVESEYGCSIPAPEI AEHLQSVRTLAGYVAAHTS NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgcataccgagcaagaactccacaccaagatcggcgagatcgtcgagtcgatcgtcatg aagaaagtcacccccgatacgcagttgattgccactggcctggtcgattcgctcgccgcc gtggacatcacgctggcggtcgagtcggagtacggctgcagcatcccggctcccgagatc gcggagcacctacagtcggttcgcacgcttgccggctatgtcgctgcccatacttcgtaa

DBGET integrated database retrieval system