Azoarcus olearius BH72: azo3198 Help Entry azo3198           CDS       T00441                                  Symbol folA Name (GenBank) FolA protein   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism azo  Azoarcus olearius BH72 Pathway azo00670   One carbon pool by folate azo00790   Folate biosynthesis azo01100   Metabolic pathways azo01240   Biosynthesis of cofactors azo04981   Folate transport and metabolism Module azo_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:azo00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     azo3198 (folA)    00670 One carbon pool by folate     azo3198 (folA)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     azo3198 (folA) Enzymes [BR:azo01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      azo3198 (folA) SSDB OrthologParalogGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-ProteinID:  CAL95814 UniProt:  A1KAF8 LinkDB All DBs Position 3519505..3519999 Genome browser AA seq 164 aa AA seqDB search MTTPRSLTFVVAIASNGVIGRNNALPWRLKADLAHFKAVTLGHPIVMGRKTWESLGRPLP GRRNMVVTRNADYRAIGAEVFATPEAAVNAVAEGPLFVIGGAQLYKELLPMADRLLITEV LADVEGDAYFPPFNLDTFRECSREHHPADADNQFAFDIVDYRRR NT seq 495 nt NT seq  +upstreamnt  +downstreamnt atgacgactccacgctccctcaccttcgtcgtcgcgatcgcctccaacggcgtgatcggc cgaaacaacgcgctgccctggcggctgaaggccgacctggcgcacttcaaggctgtcacc ctgggtcacccgatcgtgatgggtcgcaagacctgggaatcgctcggccgcccattgccg ggtcggcgcaacatggtggtcacgcgcaacgcggattaccgggcgatcggcgcggaggtc tttgcgacgccggaggccgcggttaatgcggtggcggagggccccctgttcgtgatcgga ggcgcccagttgtacaaggaactgctgccgatggctgaccggctgctgatcaccgaggtc ctcgccgacgtagaaggcgatgcctactttccgcccttcaacctcgacacattccgcgaa tgcagccgcgaacaccaccccgcggatgccgacaaccaattcgcgttcgacatcgtcgac taccgccgccgctaa

DBGET integrated database retrieval system