KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103020304
Entry
103020304         CDS       T03086                                 
Symbol
IFNG
Name
(RefSeq) interferon gamma
  KO
K04687  interferon gamma
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu03050  Proteasome
bacu04060  Cytokine-cytokine receptor interaction
bacu04066  HIF-1 signaling pathway
bacu04217  Necroptosis
bacu04350  TGF-beta signaling pathway
bacu04380  Osteoclast differentiation
bacu04612  Antigen processing and presentation
bacu04630  JAK-STAT signaling pathway
bacu04650  Natural killer cell mediated cytotoxicity
bacu04657  IL-17 signaling pathway
bacu04658  Th1 and Th2 cell differentiation
bacu04659  Th17 cell differentiation
bacu04660  T cell receptor signaling pathway
bacu04940  Type I diabetes mellitus
bacu05140  Leishmaniasis
bacu05142  Chagas disease
bacu05143  African trypanosomiasis
bacu05144  Malaria
bacu05145  Toxoplasmosis
bacu05146  Amoebiasis
bacu05152  Tuberculosis
bacu05160  Hepatitis C
bacu05164  Influenza A
bacu05168  Herpes simplex virus 1 infection
bacu05200  Pathways in cancer
bacu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bacu05321  Inflammatory bowel disease
bacu05322  Systemic lupus erythematosus
bacu05323  Rheumatoid arthritis
bacu05330  Allograft rejection
bacu05332  Graft-versus-host disease
bacu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    103020304 (IFNG)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    103020304 (IFNG)
   04630 JAK-STAT signaling pathway
    103020304 (IFNG)
   04066 HIF-1 signaling pathway
    103020304 (IFNG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103020304 (IFNG)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103020304 (IFNG)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    103020304 (IFNG)
   04612 Antigen processing and presentation
    103020304 (IFNG)
   04660 T cell receptor signaling pathway
    103020304 (IFNG)
   04658 Th1 and Th2 cell differentiation
    103020304 (IFNG)
   04659 Th17 cell differentiation
    103020304 (IFNG)
   04657 IL-17 signaling pathway
    103020304 (IFNG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103020304 (IFNG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103020304 (IFNG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103020304 (IFNG)
  09172 Infectious disease: viral
   05160 Hepatitis C
    103020304 (IFNG)
   05164 Influenza A
    103020304 (IFNG)
   05168 Herpes simplex virus 1 infection
    103020304 (IFNG)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103020304 (IFNG)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103020304 (IFNG)
   05144 Malaria
    103020304 (IFNG)
   05145 Toxoplasmosis
    103020304 (IFNG)
   05140 Leishmaniasis
    103020304 (IFNG)
   05142 Chagas disease
    103020304 (IFNG)
   05143 African trypanosomiasis
    103020304 (IFNG)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    103020304 (IFNG)
   05323 Rheumatoid arthritis
    103020304 (IFNG)
   05321 Inflammatory bowel disease
    103020304 (IFNG)
   05330 Allograft rejection
    103020304 (IFNG)
   05332 Graft-versus-host disease
    103020304 (IFNG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103020304 (IFNG)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    103020304 (IFNG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:bacu03051]
    103020304 (IFNG)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and neuropeptides [BR:bacu04052]
    103020304 (IFNG)
   00536 Glycosaminoglycan binding proteins [BR:bacu00536]
    103020304 (IFNG)
Proteasome [BR:bacu03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    103020304 (IFNG)
Cytokines and neuropeptides [BR:bacu04052]
 Cytokines
  Interferons
   103020304 (IFNG)
Glycosaminoglycan binding proteins [BR:bacu00536]
 Heparan sulfate / Heparin
  Cytokines
   103020304 (IFNG)
SSDB
Motif
Pfam: IFN-gamma API5 rva_4
Other DBs
NCBI-GeneID: 103020304
NCBI-ProteinID: XP_007195115
UniProt: A0A384B631
LinkDB
Position
Un
AA seq 166 aa
MKYTSYFLAFQLCVILGSSGSYCQAPFFKEIENLKEYFNASTPDVAGGGPLFLEILKNWK
DESDKKIIQSQIVSFYFKLFENLKDNQIIQRSMDIIKQDMFQKFLNGSSEKLDDFTKLIQ
IPVDDLQIQRKAISELIKVMSDLSPRSNLRKRRRSQNLFRGQRASK
NT seq 501 nt   +upstreamnt  +downstreamnt
atgaaatataccagttatttcttagcttttcagctgtgtgtgattttgggttcttctggc
tcttactgccaggccccattttttaaagaaatagaaaacctaaaggaatattttaatgca
agtaccccagatgtggctggtggtgggcctcttttcttagaaattttgaagaattggaaa
gatgagagtgacaaaaaaataattcagagccaaatcgtctccttctacttcaaactcttt
gaaaacttaaaagataaccagatcattcaaaggagcatggatatcatcaagcaggacatg
tttcagaagttcttaaatggcagctctgagaaactggatgacttcacaaagctgattcaa
attccggtagatgatctgcagatccagcgcaaagccataagtgaactcatcaaagtgatg
agcgacctgtcaccaagatctaacctcagaaagcggaggagaagtcagaatctgtttcga
ggccagagagcatcgaaataa

DBGET integrated database retrieval system