Balaenoptera acutorostrata scammoni (minke whale): 103020304
Help
Entry
103020304 CDS
T03086
Symbol
IFNG
Name
(RefSeq) interferon gamma
KO
K04687
interferon gamma
Organism
bacu
Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu03050
Proteasome
bacu04060
Cytokine-cytokine receptor interaction
bacu04066
HIF-1 signaling pathway
bacu04217
Necroptosis
bacu04350
TGF-beta signaling pathway
bacu04380
Osteoclast differentiation
bacu04612
Antigen processing and presentation
bacu04630
JAK-STAT signaling pathway
bacu04650
Natural killer cell mediated cytotoxicity
bacu04657
IL-17 signaling pathway
bacu04658
Th1 and Th2 cell differentiation
bacu04659
Th17 cell differentiation
bacu04660
T cell receptor signaling pathway
bacu04940
Type I diabetes mellitus
bacu05140
Leishmaniasis
bacu05142
Chagas disease
bacu05143
African trypanosomiasis
bacu05144
Malaria
bacu05145
Toxoplasmosis
bacu05146
Amoebiasis
bacu05152
Tuberculosis
bacu05160
Hepatitis C
bacu05164
Influenza A
bacu05168
Herpes simplex virus 1 infection
bacu05200
Pathways in cancer
bacu05235
PD-L1 expression and PD-1 checkpoint pathway in cancer
bacu05321
Inflammatory bowel disease
bacu05322
Systemic lupus erythematosus
bacu05323
Rheumatoid arthritis
bacu05330
Allograft rejection
bacu05332
Graft-versus-host disease
bacu05418
Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:
bacu00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
03050 Proteasome
103020304 (IFNG)
09130 Environmental Information Processing
09132 Signal transduction
04350 TGF-beta signaling pathway
103020304 (IFNG)
04630 JAK-STAT signaling pathway
103020304 (IFNG)
04066 HIF-1 signaling pathway
103020304 (IFNG)
09133 Signaling molecules and interaction
04060 Cytokine-cytokine receptor interaction
103020304 (IFNG)
09140 Cellular Processes
09143 Cell growth and death
04217 Necroptosis
103020304 (IFNG)
09150 Organismal Systems
09151 Immune system
04650 Natural killer cell mediated cytotoxicity
103020304 (IFNG)
04612 Antigen processing and presentation
103020304 (IFNG)
04660 T cell receptor signaling pathway
103020304 (IFNG)
04658 Th1 and Th2 cell differentiation
103020304 (IFNG)
04659 Th17 cell differentiation
103020304 (IFNG)
04657 IL-17 signaling pathway
103020304 (IFNG)
09158 Development and regeneration
04380 Osteoclast differentiation
103020304 (IFNG)
09160 Human Diseases
09161 Cancer: overview
05200 Pathways in cancer
103020304 (IFNG)
05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
103020304 (IFNG)
09172 Infectious disease: viral
05160 Hepatitis C
103020304 (IFNG)
05164 Influenza A
103020304 (IFNG)
05168 Herpes simplex virus 1 infection
103020304 (IFNG)
09171 Infectious disease: bacterial
05152 Tuberculosis
103020304 (IFNG)
09174 Infectious disease: parasitic
05146 Amoebiasis
103020304 (IFNG)
05144 Malaria
103020304 (IFNG)
05145 Toxoplasmosis
103020304 (IFNG)
05140 Leishmaniasis
103020304 (IFNG)
05142 Chagas disease
103020304 (IFNG)
05143 African trypanosomiasis
103020304 (IFNG)
09163 Immune disease
05322 Systemic lupus erythematosus
103020304 (IFNG)
05323 Rheumatoid arthritis
103020304 (IFNG)
05321 Inflammatory bowel disease
103020304 (IFNG)
05330 Allograft rejection
103020304 (IFNG)
05332 Graft-versus-host disease
103020304 (IFNG)
09166 Cardiovascular disease
05418 Fluid shear stress and atherosclerosis
103020304 (IFNG)
09167 Endocrine and metabolic disease
04940 Type I diabetes mellitus
103020304 (IFNG)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03051 Proteasome [BR:
bacu03051
]
103020304 (IFNG)
09183 Protein families: signaling and cellular processes
04052 Cytokines and neuropeptides [BR:
bacu04052
]
103020304 (IFNG)
00536 Glycosaminoglycan binding proteins [BR:
bacu00536
]
103020304 (IFNG)
Proteasome [BR:
bacu03051
]
Eukaryotic proteasome
Assembling factors
Other assembling factors
103020304 (IFNG)
Cytokines and neuropeptides [BR:
bacu04052
]
Cytokines
Interferons
103020304 (IFNG)
Glycosaminoglycan binding proteins [BR:
bacu00536
]
Heparan sulfate / Heparin
Cytokines
103020304 (IFNG)
BRITE hierarchy
SSDB
Ortholog
Paralog
GFIT
Motif
Pfam:
IFN-gamma
API5
rva_4
Motif
Other DBs
NCBI-GeneID:
103020304
NCBI-ProteinID:
XP_007195115
UniProt:
A0A384B631
LinkDB
All DBs
Position
Un
AA seq
166 aa
AA seq
DB search
MKYTSYFLAFQLCVILGSSGSYCQAPFFKEIENLKEYFNASTPDVAGGGPLFLEILKNWK
DESDKKIIQSQIVSFYFKLFENLKDNQIIQRSMDIIKQDMFQKFLNGSSEKLDDFTKLIQ
IPVDDLQIQRKAISELIKVMSDLSPRSNLRKRRRSQNLFRGQRASK
NT seq
501 nt
NT seq
+upstream
nt +downstream
nt
atgaaatataccagttatttcttagcttttcagctgtgtgtgattttgggttcttctggc
tcttactgccaggccccattttttaaagaaatagaaaacctaaaggaatattttaatgca
agtaccccagatgtggctggtggtgggcctcttttcttagaaattttgaagaattggaaa
gatgagagtgacaaaaaaataattcagagccaaatcgtctccttctacttcaaactcttt
gaaaacttaaaagataaccagatcattcaaaggagcatggatatcatcaagcaggacatg
tttcagaagttcttaaatggcagctctgagaaactggatgacttcacaaagctgattcaa
attccggtagatgatctgcagatccagcgcaaagccataagtgaactcatcaaagtgatg
agcgacctgtcaccaagatctaacctcagaaagcggaggagaagtcagaatctgtttcga
ggccagagagcatcgaaataa
DBGET
integrated database retrieval system