Bacillus velezensis CAU B946: BACAU_2002 Help Entry BACAU_2002        CDS       T01692                                  Symbol dfrA Name (GenBank) dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism baq  Bacillus velezensis CAU B946 Pathway baq00670   One carbon pool by folate baq00790   Folate biosynthesis baq01100   Metabolic pathways baq01240   Biosynthesis of cofactors baq04981   Folate transport and metabolism Module baq_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:baq00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     BACAU_2002 (dfrA)    00670 One carbon pool by folate     BACAU_2002 (dfrA)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     BACAU_2002 (dfrA) Enzymes [BR:baq01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      BACAU_2002 (dfrA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-ProteinID:  CCF05536 LinkDB All DBs Position complement(2195608..2196093) Genome browser AA seq 161 aa AA seqDB search MISFIFAMDENRLIGKDNDLPWHLPDDLAYFKKVTTGHTIVMGRKTFESIGRPLPNRRNI VVTSRDESSFPGCITADSAEEVLKLIPADEECFVIGGAQLYSALFPYADRLYMTKIHHVF EGDRFFPEFNEAEWELTSRKQGVKDEKNPYDYEYLVYEKKN NT seq 486 nt NT seq  +upstreamnt  +downstreamnt atgatttcgtttatttttgcgatggatgaaaaccggctgatcggaaaagataacgatctg ccttggcaccttcccgatgatctcgcatatttcaaaaaagtgacgacgggtcacaccatt gtaatggggcgcaaaacgtttgaatcaatcggacgcccgcttccgaaccggcggaacatc gttgtaacctcgcgggacgaatcttcattcccgggctgtattaccgccgactcggctgag gaagtgctcaagttgatcccggcggatgaagaatgctttgtaatcggcggcgcccagctg tacagtgcgctctttccctatgcggacagactttacatgacaaaaattcaccatgtcttt gaaggagaccgtttttttccggaatttaatgaagctgaatgggaattgacctcccgcaaa cagggagtaaaagatgaaaaaaacccttacgattatgagtaccttgtatacgagaaaaag aattaa

DBGET integrated database retrieval system