Bison bison bison (American bison): 104980052 Help Entry 104980052         CDS       T08726                                  Symbol PLA2G1B Name (RefSeq) phospholipase A2   KO K01047   secretory phospholipase A2 [EC:3.1.1.4] Organism bbis  Bison bison bison (American bison) Pathway bbis00564   Glycerophospholipid metabolism bbis00565   Ether lipid metabolism bbis00590   Arachidonic acid metabolism bbis00591   Linoleic acid metabolism bbis00592   alpha-Linolenic acid metabolism bbis01100   Metabolic pathways bbis04014   Ras signaling pathway bbis04270   Vascular smooth muscle contraction bbis04972   Pancreatic secretion bbis04975   Fat digestion and absorption Brite KEGG Orthology (KO) [BR:bbis00001]  09100 Metabolism   09103 Lipid metabolism    00564 Glycerophospholipid metabolism     104980052 (PLA2G1B)    00565 Ether lipid metabolism     104980052 (PLA2G1B)    00590 Arachidonic acid metabolism     104980052 (PLA2G1B)    00591 Linoleic acid metabolism     104980052 (PLA2G1B)    00592 alpha-Linolenic acid metabolism     104980052 (PLA2G1B)  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     104980052 (PLA2G1B)  09150 Organismal Systems   09153 Circulatory system    04270 Vascular smooth muscle contraction     104980052 (PLA2G1B)   09154 Digestive system    04972 Pancreatic secretion     104980052 (PLA2G1B)    04975 Fat digestion and absorption     104980052 (PLA2G1B)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bbis03036]     104980052 (PLA2G1B) Enzymes [BR:bbis01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.1  Carboxylic-ester hydrolases     3.1.1.4  phospholipase A2      104980052 (PLA2G1B) Chromosome and associated proteins [BR:bbis03036]  Eukaryotic type   Centrosome formation proteins    Centriole proteins     104980052 (PLA2G1B) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Phospholip_A2_1 Phospholip_A2_4 Phospholip_A2_2 Motif Other DBs NCBI-GeneID:  104980052 NCBI-ProteinID:  XP_010826925 Ensembl:  ENSBBBG00000007649 UniProt:  A0A6P3GKA4 LinkDB All DBs Position Unknown AA seq 145 aa AA seqDB search MRLLVLAALLTVGAGQAGLNSRALWQFNGMIKCKIPSSEPLLDFNNYGCYCGLGGSGTPV DDLDRCCQTHDNCYKQAKKLDSCKVLVDNPYTNNYSYSCSNNEITCSSENNACEAFICNC DRNAAICFSKVPYNKEHKNLDKKKC NT seq 438 nt NT seq  +upstreamnt  +downstreamnt atgagactcctggtgttggctgctctgctcacagtgggcgctggccaggccggcctcaac tcgagggcgttatggcagttcaacggcatgattaagtgcaagatccccagcagtgaacca ttgctggatttcaacaactatggctgctattgtggcctgggtggatcagggacccctgtg gatgatctggacaggtgctgccagacacacgacaactgctacaaacaagccaagaaactg gacagctgtaaagtcctcgtggacaatccctacaccaacaactactcctactcatgttct aacaatgagatcacctgcagcagcgaaaacaatgcctgtgaggccttcatctgcaactgt gaccgcaatgccgccatctgcttctcaaaggtgccatacaacaaggagcacaagaacctg gacaagaagaaatgctag

DBGET integrated database retrieval system