Bison bison bison (American bison): 104981315 Help Entry 104981315         CDS       T08726                                  Symbol IL18 Name (RefSeq) interleukin-18 isoform X1   KO K05482   interleukin 18 Organism bbis  Bison bison bison (American bison) Pathway bbis04060   Cytokine-cytokine receptor interaction bbis04061   Viral protein interaction with cytokine and cytokine receptor bbis04621   NOD-like receptor signaling pathway bbis04623   Cytosolic DNA-sensing pathway bbis05132   Salmonella infection bbis05134   Legionellosis bbis05135   Yersinia infection bbis05143   African trypanosomiasis bbis05144   Malaria bbis05152   Tuberculosis bbis05164   Influenza A bbis05321   Inflammatory bowel disease bbis05323   Rheumatoid arthritis bbis05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:bbis00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     104981315 (IL18)    04061 Viral protein interaction with cytokine and cytokine receptor     104981315 (IL18)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     104981315 (IL18)    04623 Cytosolic DNA-sensing pathway     104981315 (IL18)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     104981315 (IL18)   09171 Infectious disease: bacterial    05132 Salmonella infection     104981315 (IL18)    05135 Yersinia infection     104981315 (IL18)    05134 Legionellosis     104981315 (IL18)    05152 Tuberculosis     104981315 (IL18)   09174 Infectious disease: parasitic    05144 Malaria     104981315 (IL18)    05143 African trypanosomiasis     104981315 (IL18)   09163 Immune disease    05323 Rheumatoid arthritis     104981315 (IL18)    05321 Inflammatory bowel disease     104981315 (IL18)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     104981315 (IL18)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bbis04052]     104981315 (IL18) Cytokines and neuropeptides [BR:bbis04052]  Cytokines   Interleukins    104981315 (IL18) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL1 RMP Motif Other DBs NCBI-GeneID:  104981315 NCBI-ProteinID:  XP_010828633 Ensembl:  ENSBBBG00000011592 UniProt:  A0A6P3GAI9 LinkDB All DBs Position Unknown AA seq 192 aa AA seqDB search MAAEQVDYCISFVEMKFIDNTLYFVAENDEDLESDHFGKLEPKLSIIRNLNDQVLFINQG NQPVFEDMPDSDCSDNAPQTIFIIYMYKDSLTRGLAVTISVQCKKMSTLSCENKIVSFKE MNPPDNIDNEESDIIFFQRSVPGHDDKIQFESSLYKGYFLACKKENDLFKLILKKQDDNG DKSVMFTVQNRN NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atggctgcagaacaagtagattattgcatcagctttgtggaaatgaaatttattgacaat acactttattttgtagctgaaaatgatgaagacctggaatcagatcactttggcaaactt gaacctaagctctcaatcatacgaaatttgaacgaccaagttctcttcattaaccaggga aatcaacctgtctttgaggatatgcctgattctgactgttcagataatgcaccccagacc atatttatcatatatatgtataaggacagcctcactagaggtctggccgtaaccatctct gtgcagtgtaagaaaatgtctactctctcctgtgagaacaaaattgtttcctttaaggaa atgaatcctcctgataacattgataatgaagaaagtgacatcatattctttcaaagaagt gttccaggacatgatgataagatacaatttgagtcttcattgtacaaagggtactttcta gcttgtaaaaaagagaatgaccttttcaaactcattttgaaaaaacaggatgataatgga gataaatctgtaatgttcactgttcaaaaccggaactag

DBGET integrated database retrieval system