Bison bison bison (American bison): 104989774 Help Entry 104989774         CDS       T08726                                  Symbol RAP1B Name (RefSeq) ras-related protein Rap-1b   KO K07836   Ras-related protein Rap-1B Organism bbis  Bison bison bison (American bison) Pathway bbis04010   MAPK signaling pathway bbis04014   Ras signaling pathway bbis04015   Rap1 signaling pathway bbis04024   cAMP signaling pathway bbis04062   Chemokine signaling pathway bbis04510   Focal adhesion bbis04520   Adherens junction bbis04611   Platelet activation bbis04670   Leukocyte transendothelial migration bbis04720   Long-term potentiation bbis04722   Neurotrophin signaling pathway bbis04934   Cushing syndrome bbis04972   Pancreatic secretion bbis05211   Renal cell carcinoma bbis05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:bbis00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     104989774 (RAP1B)    04014 Ras signaling pathway     104989774 (RAP1B)    04015 Rap1 signaling pathway     104989774 (RAP1B)    04024 cAMP signaling pathway     104989774 (RAP1B)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     104989774 (RAP1B)    04520 Adherens junction     104989774 (RAP1B)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     104989774 (RAP1B)    04670 Leukocyte transendothelial migration     104989774 (RAP1B)    04062 Chemokine signaling pathway     104989774 (RAP1B)   09154 Digestive system    04972 Pancreatic secretion     104989774 (RAP1B)   09156 Nervous system    04720 Long-term potentiation     104989774 (RAP1B)    04722 Neurotrophin signaling pathway     104989774 (RAP1B)  09160 Human Diseases   09162 Cancer: specific types    05211 Renal cell carcinoma     104989774 (RAP1B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     104989774 (RAP1B)   09167 Endocrine and metabolic disease    04934 Cushing syndrome     104989774 (RAP1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bbis04147]     104989774 (RAP1B)    04031 GTP-binding proteins [BR:bbis04031]     104989774 (RAP1B) Exosome [BR:bbis04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104989774 (RAP1B)   Exosomal proteins of other body fluids (saliva and urine)    104989774 (RAP1B)   Exosomal proteins of colorectal cancer cells    104989774 (RAP1B) GTP-binding proteins [BR:bbis04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     104989774 (RAP1B) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 G-alpha Motif Other DBs NCBI-GeneID:  104989774 NCBI-ProteinID:  XP_010839865 Ensembl:  ENSBBBG00000012965 UniProt:  A0A6P3HMY7 LinkDB All DBs Position Unknown AA seq 184 aa AA seqDB search MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAG TEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDL EDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSS CQLL NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgcgtgagtataagctagtcgttcttggctcgggaggcgttggaaaatctgctctgact gtacagtttgttcaaggaatttttgttgaaaaatatgatcctacgatagaagattcttat agaaagcaagttgaagtagatgcacagcagtgtatgcttgaaatcttggatactgcagga acggaacaattcacagcaatgagggatttgtacatgaaaaatggacaaggctttgcgtta gtttattccatcacagcacagtccacatttaatgatttacaagatctgagagaacagatt cttcgagttaaagacacggatgatgttccaatgattctggttggtaataagtgtgacttg gaagatgaaagagttgtaggaaaggaacaaggtcaaaatctagcaagacagtggaacaac tgtgcattcttagaatcctctgcaaaatcaaaaataaatgttaatgagatcttttatgac ctagtgcgacaaattaacagaaaaactccagtgcctgggaaggcccgcaaaaagtcgtca tgtcagctgctttaa

DBGET integrated database retrieval system