Bison bison bison (American bison): 104992781 Help Entry 104992781         CDS       T08726                                  Symbol ACTB Name (RefSeq) actin, cytoplasmic 1   KO K05692   actin beta/gamma 1 Organism bbis  Bison bison bison (American bison) Pathway bbis03082   ATP-dependent chromatin remodeling bbis04015   Rap1 signaling pathway bbis04145   Phagosome bbis04210   Apoptosis bbis04390   Hippo signaling pathway bbis04510   Focal adhesion bbis04520   Adherens junction bbis04530   Tight junction bbis04611   Platelet activation bbis04613   Neutrophil extracellular trap formation bbis04670   Leukocyte transendothelial migration bbis04714   Thermogenesis bbis04810   Regulation of actin cytoskeleton bbis04814   Motor proteins bbis04820   Cytoskeleton in muscle cells bbis04919   Thyroid hormone signaling pathway bbis04921   Oxytocin signaling pathway bbis04971   Gastric acid secretion bbis05014   Amyotrophic lateral sclerosis bbis05100   Bacterial invasion of epithelial cells bbis05132   Salmonella infection bbis05135   Yersinia infection bbis05164   Influenza A bbis05205   Proteoglycans in cancer bbis05225   Hepatocellular carcinoma bbis05410   Hypertrophic cardiomyopathy bbis05412   Arrhythmogenic right ventricular cardiomyopathy bbis05414   Dilated cardiomyopathy bbis05416   Viral myocarditis bbis05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:bbis00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     104992781 (ACTB)  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     104992781 (ACTB)    04390 Hippo signaling pathway     104992781 (ACTB)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     104992781 (ACTB)   09143 Cell growth and death    04210 Apoptosis     104992781 (ACTB)   09144 Cellular community - eukaryotes    04510 Focal adhesion     104992781 (ACTB)    04520 Adherens junction     104992781 (ACTB)    04530 Tight junction     104992781 (ACTB)   09142 Cell motility    04814 Motor proteins     104992781 (ACTB)    04820 Cytoskeleton in muscle cells     104992781 (ACTB)    04810 Regulation of actin cytoskeleton     104992781 (ACTB)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     104992781 (ACTB)    04613 Neutrophil extracellular trap formation     104992781 (ACTB)    04670 Leukocyte transendothelial migration     104992781 (ACTB)   09152 Endocrine system    04921 Oxytocin signaling pathway     104992781 (ACTB)    04919 Thyroid hormone signaling pathway     104992781 (ACTB)   09154 Digestive system    04971 Gastric acid secretion     104992781 (ACTB)   09159 Environmental adaptation    04714 Thermogenesis     104992781 (ACTB)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     104992781 (ACTB)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     104992781 (ACTB)   09172 Infectious disease: viral    05164 Influenza A     104992781 (ACTB)   09171 Infectious disease: bacterial    05132 Salmonella infection     104992781 (ACTB)    05135 Yersinia infection     104992781 (ACTB)    05100 Bacterial invasion of epithelial cells     104992781 (ACTB)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     104992781 (ACTB)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     104992781 (ACTB)    05410 Hypertrophic cardiomyopathy     104992781 (ACTB)    05412 Arrhythmogenic right ventricular cardiomyopathy     104992781 (ACTB)    05414 Dilated cardiomyopathy     104992781 (ACTB)    05416 Viral myocarditis     104992781 (ACTB)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:bbis03021]     104992781 (ACTB)    03019 Messenger RNA biogenesis [BR:bbis03019]     104992781 (ACTB)    03036 Chromosome and associated proteins [BR:bbis03036]     104992781 (ACTB)    03029 Mitochondrial biogenesis [BR:bbis03029]     104992781 (ACTB)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:bbis04812]     104992781 (ACTB)    04147 Exosome [BR:bbis04147]     104992781 (ACTB) Transcription machinery [BR:bbis03021]  Eukaryotic type   RNA polymerase II system    Coactivators     BAF/PBAF complex      104992781 (ACTB) Messenger RNA biogenesis [BR:bbis03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      104992781 (ACTB) Chromosome and associated proteins [BR:bbis03036]  Eukaryotic type   Histone modification proteins    HAT complexes     TIP60 complex      104992781 (ACTB)     NuA4 complex      104992781 (ACTB)   Chromatin remodeling factors    BAF complex     104992781 (ACTB)    PBAF complex     104992781 (ACTB)    GBAF(ncBAF) complex     104992781 (ACTB)    SWR1 complex     104992781 (ACTB) Mitochondrial biogenesis [BR:bbis03029]  Mitochondrial quality control factors   Mitochondrial dynamics    Actin cytoskeleton organization     104992781 (ACTB) Cytoskeleton proteins [BR:bbis04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actins     Actins      104992781 (ACTB) Exosome [BR:bbis04147]  Exosomal proteins   Proteins found in most exosomes    104992781 (ACTB) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Actin Motif Other DBs NCBI-GeneID:  104992781 NCBI-ProteinID:  XP_010844072 Ensembl:  ENSBBBG00000009838 UniProt:  A0A6P3HXP4 LinkDB All DBs Position Unknown AA seq 375 aa AA seqDB search MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEKEMATAASSSSLEKSY ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ EYDESGPSIVHRKCF NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt atggatgatgatattgctgcgctcgtggtcgacaacggttccggcatgtgcaaggccggc ttcgcgggcgacgatgctccccgggccgtcttcccgtccatcgtggggcgcccccggcac cagggcgtaatggtgggcatgggccagaaggactcctacgtgggggatgaggctcagagc aagagaggcatcctgaccctcaagtaccccattgagcacggcatcgtcaccaactgggac gacatggagaagatctggcaccacaccttctacaacgagctccgtgtggcccctgaggag caccccgtgctgctgaccgaggcccccctgaaccccaaggccaaccgtgagaagatgacc cagatcatgttcgagaccttcaacacccctgccatgtacgtggccatccaggctgtgctg tccctgtatgcctctggccgcaccaccggcatcgtgatggattccggtgacggggtcacc cacacggtgcccatctacgaggggtacgcccttccccatgccatcctgcgtctggacctg gctggccgggacctgacagactacctcatgaagatcctcacggagcgtggctacagcttc accaccacggccgagcgggaaatcgtccgtgacatcaaggagaagctctgctacgtggcc ctggacttcgagaaggagatggccaccgcggcctccagctcctccctggagaagagctac gagcttcctgacgggcaggtcatcaccatcggcaatgagcggttccgctgccctgaggct ctcttccagccttccttcctgggcatggaatcctgcggcattcacgaaactaccttcaat tccatcatgaagtgtgacgtcgacatccgcaaggacctctacgccaacacggtgctgtcc ggcgggaccaccatgtaccccggcatcgcggacaggatgcagaaagagatcactgccctg gcacccagcacaatgaagatcaagatcatcgcgccccctgagcgcaagtactccgtgtgg attggcggctccatcctggcctcgctgtccaccttccagcagatgtggatcagcaagcag gagtacgatgagtccggcccctccatcgtccaccgcaaatgcttctag

DBGET integrated database retrieval system