Bison bison bison (American bison): 104993471 Help Entry 104993471         CDS       T08726                                  Symbol MAX Name (RefSeq) protein max isoform X1   KO K04453   Max protein Organism bbis  Bison bison bison (American bison) Pathway bbis03083   Polycomb repressive complex bbis04010   MAPK signaling pathway bbis05200   Pathways in cancer bbis05202   Transcriptional misregulation in cancer bbis05222   Small cell lung cancer Brite KEGG Orthology (KO) [BR:bbis00001]  09120 Genetic Information Processing   09126 Chromosome    03083 Polycomb repressive complex     104993471 (MAX)  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     104993471 (MAX)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     104993471 (MAX)    05202 Transcriptional misregulation in cancer     104993471 (MAX)   09162 Cancer: specific types    05222 Small cell lung cancer     104993471 (MAX)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:bbis03000]     104993471 (MAX)    03036 Chromosome and associated proteins [BR:bbis03036]     104993471 (MAX) Transcription factors [BR:bbis03000]  Eukaryotic type   Basic helix-loop-helix/leucine zipper (bHLH-ZIP)    Cell cycle controlling factors, Mad/Max     104993471 (MAX) Chromosome and associated proteins [BR:bbis03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.6)      104993471 (MAX) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  HLH JetA Filament bZIP_2 bHLH_INO4 SlyX SLX9 bHLH_INO2 DUF7801 GAGA_bind DUF4763 XhlA Csm1_N Motif Other DBs NCBI-GeneID:  104993471 NCBI-ProteinID:  XP_010845058 Ensembl:  ENSBBBG00000006077 UniProt:  A0A6P3HR16 LinkDB All DBs Position Unknown AA seq 160 aa AA seqDB search MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASR AQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKARSSAQLQTNYPSSDS SLYTNAKGSTISAFDGGSDSSSESEPEEPQSRKKLRMEAS NT seq 483 nt NT seq  +upstreamnt  +downstreamnt atgagcgataacgatgacatcgaggtggagagcgacgaagagcaaccgaggtttcaatct gcggctgacaaacgggctcatcataatgcactggaacgaaaacgcagggaccacatcaaa gacagctttcacagtttgcgggactcggtcccctcactccaaggagagaaggcatcccgg gcccaaatcctagacaaagccacagagtatatccagtatatgcgaaggaaaaaccacaca caccagcaagatattgatgacctcaagcggcagaatgctctcctggagcagcaagtccgt gcactggagaaggcgaggtcgagtgcccaactgcagaccaactacccctcctcagacagc agcctctacaccaacgccaagggcagcaccatctctgccttcgatgggggctcggactcc agctcggagtcggagcctgaagagccccaaagcaggaagaagctccggatggaggccagc taa

DBGET integrated database retrieval system